SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427733873|ref|YP_007053417.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427733873|ref|YP_007053417.1|
Domain Number 1 Region: 17-206
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.35e-53
Family Methylesterase CheB, C-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1056-1148,1178-1249
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.01e-39
Family Histidine kinase 0.0057
Further Details:      
 
Domain Number 3 Region: 1277-1401
Classification Level Classification E-value
Superfamily CheY-like 9.53e-38
Family CheY-related 0.003
Further Details:      
 
Domain Number 4 Region: 287-480
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.06e-37
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00043
Further Details:      
 
Domain Number 5 Region: 986-1067
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.14e-22
Family Homodimeric domain of signal transducing histidine kinase 0.00092
Further Details:      
 
Domain Number 6 Region: 848-972
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.62e-21
Family Heme-binding PAS domain 0.056
Further Details:      
 
Domain Number 7 Region: 219-289
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000011
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.018
Further Details:      
 
Domain Number 8 Region: 744-849
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000314
Family Heme-binding PAS domain 0.07
Further Details:      
 
Weak hits

Sequence:  gi|427733873|ref|YP_007053417.1|
Domain Number - Region: 642-738
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0547
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427733873|ref|YP_007053417.1|
Sequence length 1486
Comment PAS domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MTYKSDENNQDKTKDSQNFFVVGIGASAGGLRALEEFFENMPADSGAAFVVIQHLSPDFK
SLMKELLERYTKMKVYRVEDGMAVKPNCIYLIPPGINLVIQGRKLYFQQQDRNRPKPNFP
IDIFLQSLAEDVSDRAVGIILSGSGSDGSEGLRLLNENGGIAMSQAPQTAEFEGMPSSAI
STRLIDKIGSPQELAEVLYNYLKSPTDVQKISEDNKLLVDALKLQQITTIINRHNNINFS
HYKASTLSRRIHRRCLITESNSIDDYILRLQEDTEELEILCNDLLIGVTKFFRDAKPWQF
IENNIIPALVAQTQDGGEIRCWVSACATGEEAYSLAILLDEAISDLEKQVKVKIFATDID
KSSLEKAAAGIYPENIAKDITQERLERYFIPGIQSYEVVRKLREMLIFAPQDLTKDAGFT
RMHFISCRNVLIYMQPQLQKQVLRSLHFSLITRGYLFLGESEVVGDFEGEFLQVGNKIKI
FQKQRDILLPLSFQGFENYSKRSLQPLKSKNASKTRDVPLLEETLNAVLTENNSTCLIVN
KDNQVLHVFGNTADVLEIRYGRVTQNVVKLVVPALELPLNTALHRAKREKRSVIYTGINL
EKEDKTILVSLKVSHHQTSKVLSGDFYRVEIKQDKHLVEEESSTHYFEADTEASLHITDL
EYELQQTRENLQATIEELETTNEEQQATNEELIASNEELQSTNEELHSVNEELHTVNVQY
QSKIHELTELNSDVENLLRTTDIGVVFLDRKLKIRKFTPAATAAINLVEADIDRPLEHLS
HNMDCQDFIALLKEVIANQKQLQQEVKLNKTGVSLLMRIFPYRQDDSSFDGLVVTFVDIS
DIKKVEEQLSQTYAALQQNEQQLRAILDNTSSIIYVKDIEGRYVLINKQYLTLANSPESE
ILGKTDYELFSPDIADNLRNNDNQVIATGTSLEFEETIPLQNNLFTYLSIKAPLFDADGV
AYGICGISSDITNLLRANAKLEQQSQELIRAKQTAEAANHAKSEFLARMTHELRTPLNAI
LGFTQILNRQRNLQTQQKQYLDTILRSSHHLLGLINDILDISKIEAGMAELHITSFDLYR
LLDGIESMLYLKAKSKQLQFTFELDPEIPQYIQTDESKLRQILINILGNAIKFTDSGKVE
LRLTALASQEEKSIQESNQTKTQEQNTENPLLSSSTLSLQFQITDSGKGIATEELKSIFD
AFVQSNPTYQAQDGTGLGLAICKRFVQLMGGDIKIHSKLGEGTTVEFNIIAGVTANEQVN
QSLAKGRVIGLAPNQKEFTILVVEDNWDNRQLLIELLTPIGFQLVEANNGQEAIELWEQD
EPNLILMDMRMPVIDGYQATKQIREKEKNTQHHIPIIALTATAFNENRELILMIGCDDFI
PKPFQEEVLLEKIARHTGAKYIYELDRNLSSSANNIYLKELTPEALQVMPKEWCSQVNAA
ALNCNQSKVLQLIREIPPQYNSLQKQLNDLANNYQFDLISKLSQCS
Download sequence
Identical sequences K9R4S0
WP_015116448.1.44015 gi|427733873|ref|YP_007053417.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]