SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427733959|ref|YP_007053503.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427733959|ref|YP_007053503.1|
Domain Number 1 Region: 168-456
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 4.97e-60
Family Creatinase/aminopeptidase 0.0000194
Further Details:      
 
Domain Number 2 Region: 12-164
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 2.3e-25
Family Creatinase/prolidase N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427733959|ref|YP_007053503.1|
Sequence length 461
Comment Xaa-Pro aminopeptidase [Rivularia sp. PCC 7116]
Sequence
MTTTSTSNSLAETLRKRREKLADLIDFPAVFWSGNPSPRNFSANIFPHRPSSHFLYFAGL
PLKNTAIRLEAGKLQLFIDNPSPSSALWHGEMPSRDEIAEQIGADEAYPMAELESYLQDV
ATIAVQDAASWTQQSQLLDRWILPQRPPENKDLQLAKAVAQLRLTHDEAALDEIRQAVAV
TIEAHKAGMAATAAAKTEAQVRAAMESVIIARNMTTSYNSIVTVRGEVLHNEHYENSLNS
DDLLLADVGAETPNGWAADVTRTWAVSGKFSSTQRDIYDVVLAAHDACIDKISPGIEYED
IHLCACQVIAEGLIDLGILQGNPEELVNVDAHALFFPHGIGHLLGLDVHDMEDLGDLAGY
EEGRQRSGRFGLGYLRLNRPLHAGMVVTIEPGFYQVPAIVNNSENRDNFKQFVNWERLSQ
FADVRGIRIEDDVLVTDNGSEVLTAALPTQADAVEKLTVNG
Download sequence
Identical sequences K9R680
gi|427733959|ref|YP_007053503.1| WP_015116534.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]