SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734108|ref|YP_007053652.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734108|ref|YP_007053652.1|
Domain Number 1 Region: 180-318
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 9.37e-45
Family ATP-dependent riboflavin kinase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 13-180
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.79e-26
Family Adenylyltransferase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427734108|ref|YP_007053652.1|
Sequence length 323
Comment riboflavin kinase/FMN adenylyltransferase [Rivularia sp. PCC 7116]
Sequence
MWVTSSTELIQTPTAVALGKFDGVHRGHQRVIQPILHKPADAEHIYPTVITFLPHPQEFF
TGKPRTLLTPLDEKVQQLELLGVKQLVLIPFDKELSALTPEQFVQQIIVEKLQAARISVG
QDFCFGSKRSGTAMDLQVLVAEYGIPVTIVPLITHEDDFSVDEETERISTSLIRQKLEIG
DIERANQLLGRPYTFIGTVVKGQQLGRTIGFPTANLQLPQDKFLPRQGVYAVRVARINNQ
DTALNNCWGVMNIGDRPTVNGTHPTVEVHILDWSGDLYDKKLQIQLIKFIRPEQKFSNLA
ALKAQIQLDCNTARNFFSHEMEP
Download sequence
Identical sequences K9R5B4
gi|427734108|ref|YP_007053652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]