SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734147|ref|YP_007053691.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734147|ref|YP_007053691.1|
Domain Number 1 Region: 135-299
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000301
Further Details:      
 
Domain Number 2 Region: 392-503
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.06e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000266
Further Details:      
 
Domain Number 3 Region: 9-131
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.07e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.00039
Further Details:      
 
Domain Number 4 Region: 272-404
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.01e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427734147|ref|YP_007053691.1|
Sequence length 514
Comment assimilatory nitrite reductase (ferredoxin) precursor [Rivularia sp. PCC 7116]
Sequence
MSTTQSQKPATLNKFEKIKAEKDGLDIKDELENFAQIGWEAMEKSDLEHRLKWVGVFYRP
VTPGKFMLRMRTPNGILSTSQLRVLAEIVQRYGADGSADITTRQNIQLRGVRLEDIPDIF
RRLDGAEMTSMQSGMDNVRNITGSPVAGIDGSELVDTRELVQKVQDMITNNGKGNYAFTN
LPRKFNIAIEGGRDNSVHAEINDIAFVPAYKNEKLGFNVLVGGFFSARRCEAAIPLNAWV
PPNDDVVDLSRAILSVFRDRGSRANRQKSRLMWLIDELGIDQFRSMVEQEFGRTLESAAA
KDEIDWDKRDCIGINKQKQPGLNYVGLHVPVGRLYAQDMFDLARLAEVYGSCEVRLTVEQ
NVIIPNILDDNLEDFFTEPLLEKFSISPQPLERALVSCTGAQFCNFALVETKNRASALAK
QLDAELEIPNPVRIHWTGCPNSCGQPQVADIGLMGTKVRKDGKTVEGVDLYMGGKVGKDA
QLGTCVQKGIPCDELNNVLKRILIDSFAAKPKNS
Download sequence
Identical sequences K9R715
gi|427734147|ref|YP_007053691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]