SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734229|ref|YP_007053773.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734229|ref|YP_007053773.1|
Domain Number 1 Region: 1-24
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.000000732
Family Ribosomal protein L32p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427734229|ref|YP_007053773.1|
Sequence length 58
Comment 50S ribosomal protein L32 [Rivularia sp. PCC 7116]
Sequence
MAVPKKKTSKSKRDKRRATWRHKASVEAEKALSLGKSILTGRSTFVYPSGEEEEEDEE
Download sequence
Identical sequences K9R6Y5
gi|427734229|ref|YP_007053773.1| WP_015116804.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]