SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734363|ref|YP_007053907.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734363|ref|YP_007053907.1|
Domain Number 1 Region: 11-237
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.35e-57
Family PP-loop ATPase 0.00025
Further Details:      
 
Domain Number 2 Region: 216-326
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 2.56e-19
Family MesJ substrate recognition domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427734363|ref|YP_007053907.1|
Sequence length 337
Comment tRNA(Ile)-lysidine synthetase [Rivularia sp. PCC 7116]
Sequence
MVWTSLHANIHRTIRSRGLLQRNQRLLIAVSGGQDSLCLTQLLLDLQPKWGWHLAIAHCD
HCWRDDSQANANHVERLAGEWGIPFYLETASQSLISEAAARNWRYQVLQRIANQNNYQCI
ITGHTATDRAETLLYNLMRGSGADGLQALTWQRRLSVDGEVMLVRPLLEVTRTQTGKFCQ
DFQLQIWEDSTNQELKYARNRIRQELMPYLQEKFNPKVESNLARTAELLQAEVEYLEQAA
EELRKNAEIIDEQGDSETLLRLNRQILRKAPLALQRRTIRQVLLKIILNAPSFEHIEKLV
GLIGAANRSQTDPFPGGAVAVVEGEFILLKKKMKDKG
Download sequence
Identical sequences K9R633
WP_015116938.1.44015 gi|427734363|ref|YP_007053907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]