SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734422|ref|YP_007053966.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734422|ref|YP_007053966.1|
Domain Number 1 Region: 30-149
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 7.59e-34
Family N-utilization substance G protein NusG, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 141-212
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.53e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427734422|ref|YP_007053966.1|
Sequence length 213
Comment transcription antitermination protein nusG [Rivularia sp. PCC 7116]
Sequence
MNSATDEDRNSPLQSEETDAPSNNGVKSSRWYAVQVASGCEKRVKTNLEQRIQTFDVADK
IIQVEIPHTPTVKIRKDGSRYSTEEKVFPGYVLVKMQMEDDIWQVVRNTPHVINFVGAEQ
KRGTGRGRGHVKPLPLSHSEVERIFKQATEQQEVVKVDMATGDKIVVLSGPFKDFEGEVI
EVSPERSKLKASLSIFGRETPVELEFNQVEKQS
Download sequence
Identical sequences K9R7V7
WP_015116997.1.44015 gi|427734422|ref|YP_007053966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]