SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734431|ref|YP_007053975.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734431|ref|YP_007053975.1|
Domain Number 1 Region: 60-329
Classification Level Classification E-value
Superfamily PLP-binding barrel 6.98e-71
Family Alanine racemase-like, N-terminal domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 305-465
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.78e-50
Family Eukaryotic ODC-like 0.0000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427734431|ref|YP_007053975.1|
Sequence length 472
Comment diaminopimelate decarboxylase [Rivularia sp. PCC 7116]
Sequence
MVSTHPAGIQANGSKYILSSNQREGISPNQSLLPLSAKVNQNDNLEVGGCDVTTLVKQFG
SPLYILDEESLRTACCQYRDSFKQYYKGESQVLYASKAWNCLAVCAIVASEGLGIDVASG
GELYTAITAGADADKIYLHSNNKSRDELIFAVESGCTIVVDNWYELNTLVELAQENSFSS
YAPYRIMLRLTPGIDCHTHDYIRTGQLDSKFGFDPNALDDVFAFAIKNQASLNCVGVHAH
IGSQIFERQPHQDLAALMVEWLKKAATYGIEITELNVGGGLGIRYIESDDPPSIEEWVKP
ICEVVEKACGEANISLPKILCEPGRSLIGTTCVTAYSVGASKEIPGIRKYIAVDGGMSDN
PRPITYESIYRAVVANKMSAPLTEQVTIAGKHCESGDILIKDAQLPSTSEGDILVVMGTG
AYNYSMSSNYNRLPRPAAVLVGNGEASLILQRESYQDLIRQDCLPERLKKNE
Download sequence
Identical sequences K9R7C1
WP_015117006.1.44015 gi|427734431|ref|YP_007053975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]