SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734447|ref|YP_007053991.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734447|ref|YP_007053991.1|
Domain Number 1 Region: 142-361
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-53
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000683
Further Details:      
 
Domain Number 2 Region: 446-586
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.58e-37
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000559
Further Details:      
 
Domain Number 3 Region: 12-141
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.0039
Further Details:      
 
Domain Number 4 Region: 362-437
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.55e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|427734447|ref|YP_007053991.1|
Domain Number - Region: 588-635
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00191
Family CopG-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427734447|ref|YP_007053991.1|
Sequence length 637
Comment sulfite reductase (ferredoxin) [Rivularia sp. PCC 7116]
Sequence
MVKSAPPENTNRKSSKLEGIKERSNFLREPVATEIQEDTNRFSEEAIQILKFHGSYQQDN
RDNRAPGQEKDYQMMLRTRNPGGFIPPQLYLTLDKLSDDYGNHTMRITTRQGFQLHGILK
KNLKATIAAIVKNMGSTLGACGDLNRNVMAPAAPFKNKPEYQYAIEYADKIADLLTPQTG
AYYEIWLDGEKAISAEESPEVKAARDRNGTGTIFHDSPEPIYGTHYMPRKFKISVTVPGD
NSIDLYTQDLSLVVITDDNSQLQGFNVFCGGGLGRTHNKEETFARKADEIGYVSKEDVYD
LVKAIVATQRDYGDRVQRRHARLKYLINDWGVDKFRSKVEEYFGKSVEPFRQLPDFKYYD
YLGWNEQGDGKLFLGISIENGRVKDEGSFQLKTALRKIVEQFNLDIRLTANHNLIFLDIE
PDKKSAIEEILQNHGINSDPEKIEPLVRYAMACPALPTCGLAIAESERAIPGILDRIRKL
LNSLGLQKESFVVRMTGCPNGCARPYMAELGFVGSAPDTYQLWLGGCPNQTRLAQPYMQK
LKAEELEKQLEPMFAYFKESKETEESFGDFCNRVGFDAIREYAGSYKPKSSTIGKKLRHR
VTVRDDVYDKLKQASESQGKPMTEMVNEAIKAYLEAE
Download sequence
Identical sequences K9R7Y1
WP_015117022.1.44015 gi|427734447|ref|YP_007053991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]