SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734485|ref|YP_007054029.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734485|ref|YP_007054029.1|
Domain Number 1 Region: 869-1095
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.16e-35
Family Calpain large subunit, catalytic domain (domain II) 0.0012
Further Details:      
 
Domain Number 2 Region: 25-104
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000262
Family Collagen-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427734485|ref|YP_007054029.1|
Sequence length 1105
Comment Calpain family cysteine protease [Rivularia sp. PCC 7116]
Sequence
MPIDIGNGVNFPDSSTYLHTTQEWTTIEGKVNLNNTDNYYSVQLSSRSYFEVVLNDLSDN
ADVSLLSNDGSQVASSSLSGTRNESIARVLDAGTYFIEVHQVDDAEISYGLEYRSNHIPE
QFQFKVETVQGDISLTDTKIFDADGAGDIRKVDFWLKKEGERWGKAGIVTEFNHNSDDGS
IGFDYNIDNLEEGKYYLWGRATDNFGYRSNGWGQIFEVTNFVDPKVENVAPSRLDFTIES
SNGGIKLNDARVYDANGIDDLERVAFQLKKQGGEWIEIADATDFKQVDGNLFGFDYGISS
LEAGNYELKATAYDKAGESSESLRSFFRIDNLAPSDLAFEVEVVENGIRLTDTKVFDANG
INDLSRVDFWLKKESGNWQNIEDAVEFRSNQDEYGSIGFDYSIDSLEKGNYTLWARARDG
EDKYSNSKQATFNIGNAAPSQLDFNFREISGGIELRNARVFDADGINDLEKVDFQLQKEG
GEWIDIEDVVEFSQNNDGSIGFGYSINNLEQGNYQLKATAIDKAGENSETLTTYFKVKNA
APTDLLFDIETIDGGIRLVDTQVYDANGIADITRVDFWLKKDDEGWQDIEDAVDFSENAD
GSFSFNYNLDSLESGDYVLWARSRDKSDSYGNVEQKSFSIKNVAPSQLDFDIQTTGGRIE
LTNVRVFDANGIDDIDKVKLWLQKDNGVKQEVADISQFRKNADGSFSFDYNLDSLQNGNY
KLLARINDKANEYIELEKSFQITGVVPPQPEKDWFERNIIDTEIRNKTRTLFSDKTLNRN
DMIAILEDAKDNNIVDATEIKDFRTILSNASYLGIDDYVRVLANKVVNGDTANKSGNLQA
GSSSEQLDKLINKWFRGSERPQTAHTYQYAQGSLFQNGISHDDIRQGYINNCFFLAGLGA
TLVQSPEIIQNMFIDNGDGTFTVRFYKNGVADYVTVDRYLPTNNIGNFVYANAGDYHGNA
NNELWVTLAEKAYAQLNEAEWINQDGTNSYNGIGNAGYLSDAFKHITGEKAALGRFLSFD
KVVNAFQSGEVVGFGSKSGGVASNIVTSHAYALVDYNAETQKFTLLNPWSTDNNAVKSRT
LELSWSEITSNFSYWDSTISNVVST
Download sequence
Identical sequences K9R8R5
gi|427734485|ref|YP_007054029.1| WP_015117060.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]