SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734486|ref|YP_007054030.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734486|ref|YP_007054030.1|
Domain Number 1 Region: 406-709
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-45
Family Subtilases 0.00011
Further Details:      
 
Domain Number 2 Region: 143-247
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000109
Family Collagen-binding domain 0.0037
Further Details:      
 
Domain Number 3 Region: 33-134
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000144
Family Collagen-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427734486|ref|YP_007054030.1|
Sequence length 717
Comment subtilisin-like serine protease [Rivularia sp. PCC 7116]
Sequence
MDIKLIHTVLLDVKDMTESGTRGLLHSANQLSINTSKQIYTDTLNSIKTNDLYSFTIQGR
SSFNLSLDGLIADADVRLIRDKNANGKFDKDETIAYSNNGGTLAESINTSLAAGDYYIEV
YPYGNIETNYHLTVSAVPFDSAGNTLNNAREISVDSQTKIVSDWVGKLDSQDYYRFNLSN
SSDFKVVVAGLSADADLQLLSSQGNILANSINGGAASESINQTLETGTYYLKVYSYNSSE
TFYNLKLSASLPSQNSSNSGEMELIPTSVGNTAATSANQSSPIPTSAVPQSAGSTRSQAG
TLRADTFTFESGYSRTIFSGNGNVDFGSGGRDLIDLSQFVSTSAAFNYATNPNGGVVYNS
GNGNRIFDALTLSDGSQILFESIDAIRFADTTINLSVTTNDPQFSQQWNLHGMGVHNAWR
FTTGTSNVMIGIQDTGSGTDSSGNIHPDLRPASFIGSNYVDEWGNFSHGTLVQGGIAARS
NNGMGGAGINWNSDLMLVDVVGDNPLDYNLATATQAMIDKANAQGKRLVVNISLAGGYSV
EFEQLIAANQNTALFVIASGNGNSNSIASPADLAARYGNVVAVGSSWGTQDWYGNSRNPG
ERVAYDNWWGSNYGNGLTVTAPSEFFTTSANRNGTGSFDFAYNDKFNGTSASTANVSGVA
SLVWSANSNLSAGQVKAIISETAYDLGNQGYDEVYGHGFINADAAVRRALAIARGFA
Download sequence
Identical sequences K9R7G8
gi|427734486|ref|YP_007054030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]