SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734513|ref|YP_007054057.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734513|ref|YP_007054057.1|
Domain Number 1 Region: 342-407
Classification Level Classification E-value
Superfamily TPR-like 0.0000038
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Weak hits

Sequence:  gi|427734513|ref|YP_007054057.1|
Domain Number - Region: 308-376,423-474
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 0.00523
Family Protein prenylyltransferase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427734513|ref|YP_007054057.1|
Sequence length 547
Comment hypothetical protein Riv7116_0933 [Rivularia sp. PCC 7116]
Sequence
MKKRLVLVFTFVIINFGSGCSQAPISNSTRTETPTIITASELEESKKPKTSIEQVLENLD
RVDKSFNRIVFFLAKVVIILLSLIVIQRIVILITFRSSQLVIDNFTNASGAEGMDFVLPG
LSQLGRERLVRDIKGVHQRLKQHINSSGLRTYPPPDKLPLPQATPDERLSNLVASLNDFT
PDQIDPLVNLLKIIFPPYGTKVTSILQSQGEDYNRLGITFEVADIQGRVASRLYTIWEEN
PTETVPDTVIKTLANNSSITNAEDEEFELPAIETYPELKDRFRALLKPATRWLALEISRR
EMLANVPWYYLGNWCKRYQSQINNFFGVINYASAPTHGRFFYQLAIEDLQAAIELDPNWY
QPYENLGDTYSTQGREFQENRRVNLERQAILQYEKALARCEDETVRRRIKVGKAMAQLLT
EDENLVEESRKEIQLLEKQWNAESDLSSRFLYNLASWYAIFTGQNSEDKQTKQKARQYLI
YALLRDSDRNLWDWASRDPDFQAVRERFTDLQFALMNKLNEVNELPEVTGERFVKHVSEI
LKEMNWI
Download sequence
Identical sequences K9R6H3
gi|427734513|ref|YP_007054057.1| WP_015117088.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]