SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734606|ref|YP_007054150.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734606|ref|YP_007054150.1|
Domain Number 1 Region: 8-141
Classification Level Classification E-value
Superfamily CheY-like 3.84e-28
Family CheY-related 0.0018
Further Details:      
 
Domain Number 2 Region: 144-320
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000255
Family GAF domain 0.0075
Further Details:      
 
Domain Number 3 Region: 343-502
Classification Level Classification E-value
Superfamily PP2C-like 0.00000105
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427734606|ref|YP_007054150.1|
Sequence length 567
Comment serine phosphatase RsbU, regulator of sigma subunit [Rivularia sp. PCC 7116]
Sequence
MTEIEAGKLKLMVVDDELDNLDLLYRTFRRDFKVFKASNARSALEILDKQGEMAVIISDQ
RMPEMNGTEFFGLTVERFPDTIRILLTGFTDVEDLVEAINSGQVFRYITKPWKPDQLRGL
VEQATQTYRLVKKRTFDLRRSLRRESLVNAVTTAIRESLDYQSMLQKIVATIGKTFEAAC
CILRPVEGDKLAPDEFFYSSDDSNSENCCFNPTSLMEKVLISRDSEVAKFTSDSGESYQQ
LAVPLIYQQHLQAVLVLQQQCSDGEGANCGEYRNWQHEDIELISGVAEQAALALSQAKLY
QSLQRKQEQIHAELEVARQIQHNLLRQSLPEIEGVKVQASCYPAREVGGDFFEVFVHPKG
DLWLAVGDVSGKGVPAALFMASAISVLRRELSQETPAMPNIVMKNLNEALGDDLVSNNCF
ITLVLARYSPNTKQLVYANAGHIYPIVCSHKNSHPDRPNFLKVRGIPLGILPDWKANAGE
LILASNETLLLASDGITEAQVSMKESFSNCLSHGVESPTRSMLNQEGLWKLLLEQETPLS
LNKLLSRIHVDTEVQEDDQTILSLEVL
Download sequence
Identical sequences K9R7T8
gi|427734606|ref|YP_007054150.1| WP_015117181.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]