SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734797|ref|YP_007054341.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734797|ref|YP_007054341.1|
Domain Number 1 Region: 117-294
Classification Level Classification E-value
Superfamily E set domains 3.36e-57
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000191
Further Details:      
 
Domain Number 2 Region: 34-146
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-21
Family Voltage-gated potassium channels 0.0000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427734797|ref|YP_007054341.1|
Sequence length 302
Comment Inward rectifier potassium channel [Rivularia sp. PCC 7116]
Sequence
MSETHRRKISVRRLVNPDGDFNVVRKGVSKFDWDDLYHASLTLSWVKLFAVVGAGYIITN
IFFAFLYLTAGNGIENMREGDFFDAFFFSVQTMATIGYGAMYPKTLFANLLVAIEALLGL
LAVSVGSGLVFARFSLPKARVMFSRIAVVKPHNDVPTLMFRVANERQSWILEAQVNVSLV
TNEITEEGEAMRRFYKLPLFRNQSSLFALTWTVMHPINNSSPLYGITLEEMQEKEMEILI
TLTGIDQTVSDNIHAHHSYIPTEILWNHKFVDILSKTRNGKRSVDYNCFHDAIALEELGV
RS
Download sequence
Identical sequences K9R8V1
gi|427734797|ref|YP_007054341.1| WP_015117372.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]