SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427734806|ref|YP_007054350.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734806|ref|YP_007054350.1|
Domain Number 1 Region: 5-360,392-410
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 7.51e-107
Family B12-dependent (class II) ribonucleotide reductase 0.00016
Further Details:      
 
Domain Number 2 Region: 773-1125
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.66e-105
Family B12-dependent (class II) ribonucleotide reductase 0.00093
Further Details:      
 
Domain Number 3 Region: 408-528,710-773
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.1e-39
Family Intein (protein splicing domain) 0.0042
Further Details:      
 
Domain Number 4 Region: 599-718
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000000397
Family Intein endonuclease 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427734806|ref|YP_007054350.1|
Sequence length 1131
Comment intein/homing endonuclease [Rivularia sp. PCC 7116]
Sequence
MVRELERKHVGAEFPQTAPAANPVFFRTYSRRQQPEGTRESWSQVCDRTLKGLVELGKLT
QDEALLLEEMQRNLKALPSGRWLWVGGTNWLAQPKNFSGAYNCTSTNVIDWSAFGLMMDL
AMMGCGTGAILEPKYINQLPTIRNNLKVTVEGNIGKTIANERREFTGTEINGNQATIYVG
DSRQGWVKSYQTLLELSTDEQFTEEVEVIVDISDIRKAGEPLQGFGGMANPVKLPALYQR
CAAILNKAVGRKLTSVECCLLIDEAAVTIVAGNIRRSAGIRQGIDTDAAFTDAKANLWQQ
GEDGNWRIDPERDALRMANHSRVFHHKPTLEECVNAVRKQYYSGEGAIQWAGEAVARANV
DLLTTKELKTEFLEAYDRGEAKQWLQKRHLNLDEKELEHRLGRYGLNPCHSGDTLVSTDK
GLVPIKDLVGKPFKALVDLRSVGLEGVKLTDAIAFCTGVQTTYLVTLKNGQQMRCTADHQ
HFTNKGWVATKDLTSEHNIYIQKGEGFFGEGTITVEQAQMLGWLYGDGSIYQGSRGKDAV
FYINRHEYQTVFPVLQSAVESLTGYNHQPSFVKGIYTFHSGSPVMHSFFEQLGIESKNSL
PDKFLTESKEVIIGFLQGLFSADGCINVKGRNIELRNRSRQLLAQIQIILLNLGIKSSLI
IKQKPGAPGVPYTLKDGTEKVSRNQGSWRLIIYSGDGARQFRKVVAFPLVPEKQERLEKI
AAYKVSRNYSEAVISSRYASKLKSIEEYGEEPVYDLHVPLTHSFIANGCITHNCGEIIGS
NFHCNLSEIHLNQIDPENHKEQEQAFTAGALSVAALLNHKFLEPRYQYSRELDPIVGVSF
TGLFDFFVRAFGVDWLRWWSEGRPATNEGLAFKRREQEYLSMWKDIVHRVVWEYCDRNNI
KRPNRCTTVQPSGTKSLLTGASPGWHPPKAQRFIRRITFRKNDPVAMACIDYGYAVVPSQ
TDKDENGNLLNDPFDSRCTEWLVEIPVAVPWADVPGADQIAIDKFSAFAQMDFYMQVQQF
YVTHNTSATIEVRENEVEELGNKIYQAIQNDEGYISAALLARFDDHETFPRLPFEPISKQ
QYDELMQQVEKRRDTNNFYSALKRYDFGELMEAGPSGCDSDKCMMPEEKPM
Download sequence
Identical sequences K9R8F3
gi|427734806|ref|YP_007054350.1| WP_015117381.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]