SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427735064|ref|YP_007054608.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735064|ref|YP_007054608.1|
Domain Number 1 Region: 2-166
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 9.55e-35
Family N-terminal domain of MutM-like DNA repair proteins 0.00082
Further Details:      
 
Domain Number 2 Region: 164-254
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.39e-29
Family Middle domain of MutM-like DNA repair proteins 0.0016
Further Details:      
 
Domain Number 3 Region: 250-300
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.93e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427735064|ref|YP_007054608.1|
Sequence length 301
Comment formamidopyrimidine-DNA glycosylase Fpg [Rivularia sp. PCC 7116]
Sequence
MPELPEVETVRRGLNQLTLKRKITGGDVLLDRTIAYPFSAEDFLNGLQQREITTWHRRGK
YLIAELSSVLEDKETREQGDKNSSSLATFSLPSSSLGVHLRMTGQLLWLNQNEPLHKHAR
VRLFFGEEWELRFVDQRTFGQMWWVPPKVETQSIITGLAKLAADPFSTEFTVDYLADKLK
NRRRPIKTALLDQSVVAGLGNIYADEALFLSRIQPQTLCLNLQREQIQRLHSAIIQVLKT
SIEAGGTTFSNFLNVQGVNGNYAHVAWVYNRTGEPCRTCSNPIERIKLAGRSSHFCPECQ
Q
Download sequence
Identical sequences K9R9E2
WP_015117637.1.44015 gi|427735064|ref|YP_007054608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]