SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427735103|ref|YP_007054647.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735103|ref|YP_007054647.1|
Domain Number 1 Region: 37-220
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000111
Family GAF domain 0.01
Further Details:      
 
Domain Number 2 Region: 232-460
Classification Level Classification E-value
Superfamily PP2C-like 0.000000458
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427735103|ref|YP_007054647.1|
Sequence length 462
Comment serine phosphatase RsbU, regulator of sigma subunit [Rivularia sp. PCC 7116]
Sequence
MSQLPSQPADSNSSAPTDVTPVVALKELVARLHREQNKIQDLLSSLGFALRSFNNLNQFL
ELIPLMATRVTDADGSALFLYKPNGQVRLEQLHWQDSRQRKNIRKALEAASSQISLPTNA
TPLATTTGMLDAHMHRCLGPDMQAFGTAILVKHMERGWLYVLSRDPEYTWTETRQKLVRL
VADQTAVAIENDELGVELRKKERLDQELEIGAEIQRRLLPRQCPNIPGVALAARCKPANH
VGGDYYDFIPTNHNLTIKGKDSDNPDANRWAMVIGDVMGKGVPAGLIMTMMRGMLRGEVL
HLNSPAQILQNLNRVMYADLDNSSRFITLFYSEYDPHKRLLSYSNAAHNPPLWWHAATKT
VSRLDTNGMLIGLEANSQYENGQIYLESGDTIIYYTDGLTDAASPSGERFDEENLIVAFN
NACRYYKDPQEILDCLFNEIKQFIGTDRQNNDDMTLVVLQAR
Download sequence
Identical sequences K9R871
gi|427735103|ref|YP_007054647.1| WP_015117676.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]