SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427735149|ref|YP_007054693.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735149|ref|YP_007054693.1|
Domain Number 1 Region: 126-274
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 8.67e-40
Family Aspartate/glutamate racemase 0.00018
Further Details:      
 
Domain Number 2 Region: 23-124
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 9.97e-34
Family Aspartate/glutamate racemase 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427735149|ref|YP_007054693.1|
Sequence length 297
Comment glutamate racemase [Rivularia sp. PCC 7116]
Sequence
MFSSSIFEGNLYHLSQQEPQRAPIGIFDSGVGGLTVLRQLYEQLPSESIIYFGDTARLPY
GIRSQEEIIQFTREIIFWMESQGVKIVIMACSTSSALALETVRCEFKVPILGLILPGAVS
AVKAGKRIGVIATPATAKSNAYKQAIQEINSNAQVWQVGCPEFVPLIEQNRVDDPYTKKV
ARSYLEPLLDRDIDTLVYGCTHYPHLATLLRSLLGESVQLVDPGKSVVEACVQELDLLGL
KNNFPPLPTKFAVSGSPQQFAQSSVQWLGCTPIVESVNLEHLDSSHFPQDSGGLISY
Download sequence
Identical sequences K9R9M7
WP_015117722.1.44015 gi|427735149|ref|YP_007054693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]