SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427735239|ref|YP_007054783.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735239|ref|YP_007054783.1|
Domain Number 1 Region: 30-340
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.44e-28
Family Filamentous hemagglutinin FhaB, secretion domain 0.0063
Further Details:      
 
Domain Number 2 Region: 1269-1416
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000204
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|427735239|ref|YP_007054783.1|
Domain Number - Region: 921-1010
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000104
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Domain Number - Region: 669-860
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00113
Family Filamentous hemagglutinin FhaB, secretion domain 0.05
Further Details:      
 
Domain Number - Region: 856-922
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00314
Family Filamentous hemagglutinin FhaB, secretion domain 0.025
Further Details:      
 
Domain Number - Region: 1013-1129
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00377
Family P22 tailspike protein 0.058
Further Details:      
 
Domain Number - Region: 1147-1283
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0131
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427735239|ref|YP_007054783.1|
Sequence length 1641
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MFQKMQYWQFKTWVIFWLFLSGIPTIVGENQVQAQIVPDNTLGNESSIVTPVNTQLERID
GGAIRNNNLFHSFTEFNIGEGREAYFSNPAAIENIFSRVTGSNPSRIFGKLGVLGDANLY
FLNPNGIIFGENSSLDIKGSFFASTANSLDFGNDNKYSAINPSAPPLLSVNVKPPIGLEF
EGMGGDINSQGNLTVGKDLNLNANNLKLQGRLQAGRNLTLKAETVNVRDSVEKPFIAAAN
GNLLVQGKESVDIFALNNPRSGLFSAGNMTLSSANPVMGDIHFWSGGNFGIEKLDKTKGD
LFSFYDPIIRSQGDVSIFGYQGASLHILAGGKVDINTAIITNPDTTGESINPVSTPKLAN
VTLSDGTSLVIDGSKKPTLDIRAGVNAAVIGNPLGTLGDSGIFFDASIVPVASPGNNSVA
TSADITIGDVFITAPNGTVLLTNQYEPNLSLQGGDINVNGAELIPSLNGIYTSFGGNGGE
ITIDSRSNISTATINSSSVNRLGNSGNGGEIKFIATKDISTTEIDSSSSSNRGNSGNGGS
IAFSTSGKIFIAGDIDSSSYSGSGISGNGGKIQLNAGEDISTFVDLTSSGKLIPGDLDSS
SLSNNGSSGYGGDITLGSGKDISVGFIVSSSSVSEGSAGDGGKVTILANRDIATQSIESY
SSGKFAGNGGAIFLNAGRDILTTTDGSAGSLLSNSASSRGGNAANGGEINLNAGRNIFRG
GIFSRSVTNGGGDAGNGGAVTLTAGDEILIINVESFSSPRYLTENFFSSGSSENFGSVGD
GGNINITTGKKITIENSKGLSRLNASGKNGGDIILRQLTENISISDIPVNSNGSNQGDGG
NILIEGESVSLFNTDITTTKTGEGNAGKITIATPGDVLLNRSRLLTALETGAVGRGGDID
IDANSVNLTNFSSINTSTYGKGDAGNLLIRADDSVSLANSSIFSITAGEGNAGQVKLQAG
KDISLTGLSIISTAVNSRATGAGNNITIEANSLSLSGRSQLQALTQGGGNSGNIKVTTAN
DINIFGISGDSFSSGIFTLSEENSRGQGGNITLNTGGRLRLSNGVVLNAQTASEQKGGNI
QVNARILELTNGAQFLTNSLSSGKAGNIDVNATEYIIISGNDPNSGNKDTVSSLPRKLPE
PKEPEIINEVEPNNSFAQSQGIDTLFSLDSPDNFNTNIEFSTRIPYVSILGTGPEVGTAD
IYSFEVEAPGTRATFDIDRGIAGGGTPDFANRRLRLFDGKGSLLAENIKAPSAARGAGGS
FTNSDPYLNFVFTEPGRYFIQVELPNTDGISTPKDYTLQASLDTSNIAGRILTNSDASGL
FAQTENIGEAGGIKINTPQLTIQNGAKVSALTSNQGNGGNITLNIKDNLTLSGEETGIFA
NTTEESTGNGGSIIIDPETVNIKDGAQISVDSQGSGIGGDIELAAGTLNLDRGRISATTR
SNTGGNIELNIQDLLLLRNRSQISTTAGEEKFGGDGGNIKINTPDGFIVAFPNENSDITA
NAFSGNGGNVDITAFGIFGIEFRDKLTAFSDITASSELGFDGNVNIETPGIEPNPETVEL
PEDAQSTEVAQGCQVSGEAAVAFFNIGRGGLPQQPGETLRSEDIIAAWIPLVMEGESQVD
KKIVAPARNANTKLLFSGCRS
Download sequence
Identical sequences K9R9W2
WP_015117812.1.44015 gi|427735239|ref|YP_007054783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]