SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427735444|ref|YP_007054988.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735444|ref|YP_007054988.1|
Domain Number 1 Region: 409-586
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.54e-43
Family Pyruvate oxidase and decarboxylase PP module 0.001
Further Details:      
 
Domain Number 2 Region: 37-218
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.22e-29
Family Pyruvate oxidase and decarboxylase Pyr module 0.0014
Further Details:      
 
Domain Number 3 Region: 201-381
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.51e-26
Family Pyruvate oxidase and decarboxylase, middle domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427735444|ref|YP_007054988.1|
Sequence length 616
Comment thiamine pyrophosphate-dependent protein [Rivularia sp. PCC 7116]
Sequence
MVQNLTKRASPHNVNDRKEVLSGSCIEATASEIIQESNENMTVADAVAQMFENLGVKSAY
GVSGGAMASLWGALSNSDIDVLNFRHEAGAAFAATEGYFASGNPTVVFTTAGPGITNALT
GLFAARGEGAKVILLSACTSAPQRGRWAIQETSTDTLPSSGIFTTGTVFNYASTVESAAQ
LPQIFRKLAVGMSQPGGYVAHLTIPTAVQNMLMDETQLPEQGVSCSLVTADAQVVGNVAK
LLRSGTFAIWLGFGARGAASEIRQLAEKTGAAVMCSPRGKGIFPENHPQFIGVTGLGGHG
SVMTYMQEQAPVRTLVLGSRLSEPTSFWNQEMVPSEGFIHVDVDANVPGVAYPHAETIGI
VSDVKAFVLQLLDILEAEEISESQLKASQPSSLPKPERSPVEAGSESLIRPEILMEAIQK
VIVDGTDAVVMAECGNSFTWSTNLLRFSQANRYRVSTGVGAMGHAVTGVVGAAQARDGIA
VAIVGDGAMLMNNEISTAVKYQIPAIWIVLNDARYNMCHQGMKMLGMTGADAIIPETNFE
MIARGMGAKGIRVTKESEITAALETAIAANGPIIIDVLIDPDRPAPSKGRNKGLASQGVK
STSEQKPKVQASFPNI
Download sequence
Identical sequences K9RAI3
gi|427735444|ref|YP_007054988.1| WP_015118017.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]