SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427735613|ref|YP_007055157.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735613|ref|YP_007055157.1|
Domain Number 1 Region: 138-477,506-580
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.12e-135
Family Amylase, catalytic domain 0.000000233
Further Details:      
 
Domain Number 2 Region: 7-150
Classification Level Classification E-value
Superfamily E set domains 1.01e-44
Family E-set domains of sugar-utilizing enzymes 0.0037
Further Details:      
 
Domain Number 3 Region: 595-705
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.88e-23
Family alpha-Amylases, C-terminal beta-sheet domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427735613|ref|YP_007055157.1|
Sequence length 717
Comment isoamylase [Rivularia sp. PCC 7116]
Sequence
MYLSLWPGKPLPLGANWDGKGTNFALFSENATAVELCLFDKEGRETRLALREVSNFTWHG
YVPSIGPGQRYGFRVHGAFAPHEGHRFNPNKLLIDPYSYAVDGEIGFGEEIFGYRWDDPK
DDLGFSELNDAHLIPKSVVVDKSFDWEGDELLQTPWHETVIYETHVKGFTKLHEEIPAKL
RGTYAGLAHPATISHLQSLGVTAVELMPIHHFLSQPGHLVGSGLKNYWGYDSISYLAPYS
GYSASGSLGQQLKEFKHMVKRLHQAGIEVILDVVYNHTGEGNHMGPTISLRGIDNASYYR
LVDGDLRYYMDFTGCGNSLNVRHPQVLKLIMDSLRYWVLECHVDGFRFDLASALARELYA
VDKLAAFFDIIHQDPVLADVKLIAEPWDVGEGGYQVGEFPLLWSEWNGKYRDTVRDFWRG
EDSRLAEFAYRFTGSSDLYEFNGRSPSASINFITAHDGFTLNDLVSYNEKHNEANNEGNR
DGESHNRSWNCGAEGETEDFAIEKLRKKQRRNFLVTLLLSQGVPMIVMGDEMGRTQGGNN
NPYCQDNDISWLDWDLQEENENLLDFTRQLIDFRRRHPVFKRRKWFQGRAIRGTEVTDIS
WFNPDGGKMTEEQWNSGFAKAIGIFLNGEGIASPGPRGERIIDENFLILFNAHYELLEFI
IPPELQEWEWVTIVDTTKPRFVQRGKRYIEDKPIKVESRSIVILQRLGQLSQEYDYE
Download sequence
Identical sequences K9R9K5
WP_015118185.1.44015 gi|427735613|ref|YP_007055157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]