SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427735894|ref|YP_007055438.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735894|ref|YP_007055438.1|
Domain Number 1 Region: 1-308
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.57e-74
Family Cytidylytransferase 0.0081
Further Details:      
 
Domain Number 2 Region: 243-430
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 1.72e-27
Family gamma-carbonic anhydrase-like 0.019
Further Details:      
 
Domain Number 3 Region: 636-743
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.71e-19
Family Phosphoglucomutase, first 3 domains 0.0085
Further Details:      
 
Domain Number 4 Region: 371-557
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.000000000000406
Family Phosphoglucomutase, first 3 domains 0.0034
Further Details:      
 
Domain Number 5 Region: 745-831
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.0000000000173
Family Phosphoglucomutase, C-terminal domain 0.01
Further Details:      
 
Domain Number 6 Region: 531-631
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.000000000029
Family Phosphoglucomutase, first 3 domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427735894|ref|YP_007055438.1|
Sequence length 842
Comment Nucleoside-diphosphate-sugar pyrophosphorylase family protein [Rivularia sp. PCC 7116]
Sequence
MRAVLMAGGSGTRLRPLTCDLPKPMVPILNRPIAEHIINLLKRHNITEIIATLHYLPDTM
RDYFQDGSDFGVQMTYAVEEDQPLGTAGCVKNIAELLDDTFLVISGDSITDFDLTAAIKY
HKEKKSKATLILTRVPNPIEFGVVITDQEGSIKRFLEKPSTSEIFSDTVNTGAYILEPEV
LQYLPENQESDFSKELFPLLLEKGEPMYGYIASGYWCDVGHLDAYREAQYDVLNHKVKAD
FPYKEVAPGLWVGQNTHIESSAVIETPALIGDNCRIGNRVHIEAGTVIGDNVTIGSDANL
KRPIVWNGAILGDEAQLSACVISRGTRVDRRAHVLEAAVVGSLSTVGEEAQISPSVRVWP
SKKIESGAILNINLIWGNTAQRNLFGQRGVQGLANIDITPEFAVKLGAAYGSTLKPGSEV
TVSRDQRNVSRMATRSLIAGLMSVGVEIQNLDATALPIARTIIPNMKVAGGIHVRVHPNR
PDYLLIEFMDNKGINIPKAKEKKIEGAYFKEDMRRAQIHEIGNVAYPAQLVDRYCNAFEN
LLNIDTIRHSRAKVVIDYVYGVSGAVLPQMLDQFGADAVVLNASLNKIAPSETDREALLT
QLGHVVEALKANFGVQVTANGEQMILVDESGIPIRGEMLTALMVDMILTANPRGSVVVPV
HTSSAVEQIARRHDGKVIRTKANPTALMEACQKNPNVVLGGSGDTGFIVPELHPGFDSMF
CIAKLIEMLTIQERSLTTVRSELPRVIHKTYTTRCPWTVKGALMRHLVETHPQEQLELID
GVKICQPYEDSWVLVLPDASEPLVHLYVNSNDRDWVDESLRKYRARVQEFVETEQEQVVV
EV
Download sequence
Identical sequences K9RBT7
gi|427735894|ref|YP_007055438.1| WP_015118466.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]