SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427736123|ref|YP_007055667.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736123|ref|YP_007055667.1|
Domain Number 1 Region: 5-238
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.34e-77
Family SAICAR synthase 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736123|ref|YP_007055667.1|
Sequence length 245
Comment phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rivularia sp. PCC 7116]
Sequence
MSVNSKLYEGKAKILYQTDVPEILLADFKDDATAFNAQKRGTISNKGTINCSISSKLFQK
LEQNGINTHYLDNPTSNQMRVKAVRIIPLEVVVRNIAAGSLCKQTGLELGTLLKKPLVEF
YYKNDELGDPLLTKERLLLLELASEEQVEEIIHLTLRINEFLKDFFGKCDITLVDFKLEF
GVDSQQRLLLADEISPDTCRLWDNSTNDSKDRVLDKDRFRKDLGNVENAYQEVLERVLKT
VEANI
Download sequence
Identical sequences K9RAY8
gi|427736123|ref|YP_007055667.1| WP_015118693.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]