SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427736151|ref|YP_007055695.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736151|ref|YP_007055695.1|
Domain Number 1 Region: 116-213
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 4.19e-39
Family Ribosomal protein S3 C-terminal domain 0.0000191
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.05e-32
Family Prokaryotic type KH domain (KH-domain type II) 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736151|ref|YP_007055695.1|
Sequence length 250
Comment 30S ribosomal protein S3 [Rivularia sp. PCC 7116]
Sequence
MGQKINPIGFRLGITKEHQSRWFADPSRYPELLQEDHKLRQYIDNKLGRNAQNNAGISEV
KIERKADQIDLEVRTARPGVVVGRGGQGIEALRTGLQKELGGNRQIRINVVEVQRVDADA
FLIGEYIAQQLERRVSFRRVVRQAIQRAQRAGVQGIKIQVSGRLNGAEIARTEWTREGRV
PLHTLRANIDYAYVTAKTIYGILGIKVWVFKGEVIPGEEEAPTSNPRNEREPRRRQNRRR
PSFEDRSNEN
Download sequence
Identical sequences K9RCE2
gi|427736151|ref|YP_007055695.1| WP_015118721.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]