SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427736572|ref|YP_007056116.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427736572|ref|YP_007056116.1|
Domain Number - Region: 111-170
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00483
Family Recombination endonuclease VII, N-terminal domain 0.0065
Further Details:      
 
Domain Number - Region: 199-234
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0211
Family Arc/Mnt-like phage repressors 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427736572|ref|YP_007056116.1|
Sequence length 236
Comment restriction endonuclease [Rivularia sp. PCC 7116]
Sequence
MVQQNNQNSDFEVYLSRVEQHISTLSGKPKKLSQVKILILRTLWEEGSQFPKGWVLSNKL
LQLTEQKYFDRRIRELRNEAGCTIETGIFNGRSAYRLLTDQLGQAFDRTYLTAAQKKKLF
EKFNYQCAVCNRSFSPGEKGLEADHKIPLIRGGSSNLDNWQALCIDCNVSKRRSCQDCQE
NCYQCAWTFPENYGQITPVSLPNQLLNSLREIAQKKGVHSQDLIIEAVEKLIKEQS
Download sequence
Identical sequences K9RE08
gi|427736572|ref|YP_007056116.1| WP_015119137.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]