SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736654|ref|YP_007056198.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736654|ref|YP_007056198.1|
Domain Number 1 Region: 16-105
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.14e-24
Family Pentapeptide repeats 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|427736654|ref|YP_007056198.1|
Domain Number - Region: 118-224
Classification Level Classification E-value
Superfamily Nuclease A inhibitor (NuiA) 0.000235
Family Nuclease A inhibitor (NuiA) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736654|ref|YP_007056198.1|
Sequence length 225
Comment putative low-complexity protein [Rivularia sp. PCC 7116]
Sequence
MDKEEFLRRYKDGERDFSGIELRDVDLSGIHLYDVIFRRAKLIKVNLSKARLWRVDLSEA
DLTGSNLFEADLKEANLRNAILTNTNLDCTELIGADLTGSNIDKAINVSSPHLLVVDESK
NNNTELVKELRELTRGLENWHNTEGGEPIDVFMWDTASRGDFTLEKFLEAAGFLVKVDSI
DFLENKFPVEEFSFIFQQIKSDISERDYYYLKIGIGWIIYIVGKI
Download sequence
Identical sequences K9RDV1
gi|427736654|ref|YP_007056198.1| WP_015119219.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]