SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427736804|ref|YP_007056348.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736804|ref|YP_007056348.1|
Domain Number 1 Region: 183-643
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.2e-118
Family Amylase, catalytic domain 0.00000000523
Further Details:      
 
Domain Number 2 Region: 651-754
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.87e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.00027
Further Details:      
 
Domain Number 3 Region: 15-118
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000595
Family E-set domains of sugar-utilizing enzymes 0.014
Further Details:      
 
Domain Number 4 Region: 141-197
Classification Level Classification E-value
Superfamily E set domains 0.0000000028
Family E-set domains of sugar-utilizing enzymes 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736804|ref|YP_007056348.1|
Sequence length 765
Comment alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase [Rivularia sp. PCC 7116]
Sequence
MTMTTIAPEQVNSIINNQHSDPFKILGSHKIEKDGKNVWVVRAYLPTASAAWVVLPEERK
EEPMQSVHDPHFFECTVDAEELANYQLKIKEEDQERVFYDAYAFNSPKLTEFDLHLFNEG
NHHRIYEKLGAHFTEIKGVKGVYFAVWAPNARNVSILGDFNSWDGRKHQMRKGPTGVWEL
FIPGLEVGEHYKYEIKNTAGHIYEKSDPYGFAQEVRPKTASIVTDLDAYKWNDSEWMEKR
RHSDPLSEPISVYELHLGSWLHAGTDEPSLLPDGTSEPVVQVSELKTGARFLTYRELAAK
LIPYVKELGYTHIEMLPVAEHPFDGSWGYQVTGYYAPTSRYGSPEDFMYFVDECHKNGIG
VLVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYSRHEVRNFLTANAL
FWFDKYHIDGIRVDAVASMLYLDYCREPGTWVANEYGGRENLEAVEFIRSVNHLIFSYFP
GSLSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNLTFSM
WYHHSENFMLALSHDEVVHGKSNIIGKMPGDRWQKFANARCLFAYMFAHPGKKTMFMSME
FGQWSEWNVWADLEWSLMQFEPHQQLKIFFQDLNKLYRNEPALYTQDFEEAGFQWIDCSD
NRHSVVSFIRRDKDSDGFVVAICNFTPQPHSHYRIGVPEPGFYTELFNSDAREYGGSNMG
NLGGKWTDSWSMHNQEHSLDLCLPPLGVLVLKLDRNKTGEVMEEE
Download sequence
Identical sequences K9REA0
gi|427736804|ref|YP_007056348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]