SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427736884|ref|YP_007056428.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427736884|ref|YP_007056428.1|
Domain Number - Region: 328-369
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.000113
Family Sigma4 domain 0.035
Further Details:      
 
Domain Number - Region: 95-194
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 0.0298
Family Cryptochrome/photolyase, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427736884|ref|YP_007056428.1|
Sequence length 370
Comment CRISPR-associated protein, Cas6 family [Rivularia sp. PCC 7116]
Sequence
MPIRRTRKKSSAIITLPTDTELVGIVFHISPASNYTIFPEYAKGLHAWFLNQVRQTNPEL
STYLHDGESEKPFTISRLQGKFLSNDAKLQLAADSNYQWYVSALSSRLVAWMADWLQNLP
KTIELHNAPLQIKSVEIAHPATTYKKLLENKKAKNTLSLSYISPTSFRRKKHHFPLPLPF
NIFQSYLRRWNDFSNLPVEQDTFLEWVDENVIIQRHQISTTRVPGGKRGLVTGFTGAVEF
GLGKEASKEPEYVNLYRALGKLAPYCGTGHKTTFGLGQTRLGWLIEEEKIEVVSPQELLA
NRIAQITEILMSKQKRTGGSRAISVCQKRAAIMARRETGESLQDIATDLDIPYETVKTYV
KLTRKMLAES
Download sequence
Identical sequences K9REI7
gi|427736884|ref|YP_007056428.1| WP_015119447.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]