SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427736888|ref|YP_007056432.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736888|ref|YP_007056432.1|
Domain Number 1 Region: 63-230
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.62e-47
Family Protein prenylyltransferase 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427736888|ref|YP_007056432.1|
Sequence length 247
Comment hypothetical protein Riv7116_3429 [Rivularia sp. PCC 7116]
Sequence
MAFCSRFVASGLTAFLILGCSDWAESTRQDNKKAVQETNVARLLTQASVRQTEDFFVQGN
KFLEANRYEDAIAAYDQVVIAAPDNAEAWINRGNALAALQRYGQALGSYDRAIAVQPKRD
EAWYNRGNTLSAMRLYQEAVVSYDKAIAIKPDKYEAWINRGIALTNLQRYKQALASYDKA
IAIKPDKHQAYYNKACTYALQKNTTAAMDNLQKAMKLFPGKYEKLAKIDPDFAKVRNTKQ
FQELIQR
Download sequence
Identical sequences K9RD65
WP_015119451.1.44015 gi|427736888|ref|YP_007056432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]