SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427736939|ref|YP_007056483.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736939|ref|YP_007056483.1|
Domain Number 1 Region: 99-467
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.87e-95
Family Amylase, catalytic domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily E set domains 0.000000000012
Family AMPK-beta glycogen binding domain-like 0.059
Further Details:      
 
Domain Number 3 Region: 471-551
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000568
Family alpha-Amylases, C-terminal beta-sheet domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427736939|ref|YP_007056483.1|
Sequence length 552
Comment 1,4-alpha-glucan-branching protein [Rivularia sp. PCC 7116]
Sequence
MAKPIEFKLFAPYNKEAALSGCFSDWESIAMEKGEDGYFRLKVDLEDGVYKYKFKVRSKS
WFFEEDQWVDVTDPYATDIDALGGYENGIVRIKDGERIVDTYVWFHDDKPLPPDNELVIY
ELHVADFSGGEDDKYARGKYQHVIEKLDYLVELGINAIELMPIKEYPGDYSWGYNPRHFF
ATETSYGETADLKKLIDECHGKGIRVLMDVIFNHSEASAPLTQIDHDYWYHHEPRDPDNN
WGPEFNYEKYDDNLDTYPARRFIGDTVRFWIEEYHIDGIRYDAARQIANYDFMHWIVDEA
KKTAGAKPFYNIAEHIPETTSITNLDGPMDGCWHDSFYHCIREHICGDKFDLEELKDVID
CKRQGFMGATNVVNYITNHDHDRIMVELGDREVFDKEAFHRLKLAAAILMTAVGVPMVWM
GQEFGEYKPQTPESSKIEWGLLENDLNRGLFEYYKGLINLRKNNHALYGENIEFIHENPE
AKVLAYTRWNDEGSRIVVVANFSENFLAGYKVPNFPATGTWHEWTANYDIEAGDDGIMTD
LGHFEAKVFVWR
Download sequence
Identical sequences K9REN5
WP_015119502.1.44015 gi|427736939|ref|YP_007056483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]