SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737217|ref|YP_007056761.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737217|ref|YP_007056761.1|
Domain Number 1 Region: 495-666
Classification Level Classification E-value
Superfamily TPR-like 3.98e-48
Family Tetratricopeptide repeat (TPR) 0.0015
Further Details:      
 
Domain Number 2 Region: 616-783,832-865
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 4.71e-43
Family Protein prenylyltransferase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427737217|ref|YP_007056761.1|
Sequence length 1381
Comment hypothetical protein Riv7116_3769 [Rivularia sp. PCC 7116]
Sequence
MQQMLRRLVQRFIKFIQDIFAGKQTPSMREREMHTVRELPELTNSDLEFLFTQLLEGVHQ
ARGQHWAQRWLQNIEHRVSVQRWLEWLQHFGKKVLASSAPNYELASRMVELGELEIGEIG
DVAYDIGVQLLTRNSKQQPAYSIPISTESAGLTPATPVSEQLIIEPSGVNKEEPIIESIA
VDGEFEAANDEANSPGQELIKEFGELLWEDYEPQPQAITPEINNLPASGEDFSRVLYEQV
FEYEEESVTIDNSNSTALEEELRDSLYEQVFESEQLEEEQLEDKTVIAENIPEQTIFTPE
TQSTEETVTSATNEITPGQDLVRNLGDLLWEDETEQVEEKSYQNVAEQEFINDLSDLVWD
YPDRDTSDTVIVPTPDYVRGVEEPINTSFVPVENNFEDSVEDEESEESIETFNALLELAD
EVEDEEDEETTAIFETSTNPQESISATVTAADAEELSAKLNESTNLVNTLASGIGNQQSS
SLVVRGMAIDNETVAQQAEAWYFQGLAQARAGNLEAAVQFYEQAVQIKPDVHEYWFNRGL
TLFHLGRLEDAIASYDKAIEINNDFYKGWYNRGRALGELGYLEDAIISFNTALEIRPNYQ
EAWSNNGLALLKLGRVDEAVFCYDKSLELEPLDTENWYYRGVALSGNGEYENAIDSYDKA
LEIEPFLHDAWIDRGVAQGQLGEWAEAIISWDKALGLRPDFYLTWFNRAVAFDNLGRRKE
AVASYDKALEIEPNFHLAWYNRAVALFYLEQYEQAILCYDRALQIKADYWEAWLGRANAA
EKSQVFDWELSLSSPVAGSNSALNARGEEGKLASYLEALKYIGDDTHPEGWGRLHLAIGN
CYYDIGKRYSSPRDYWYQAVDEYNQALVTITADDFPDLHLELLHNFIRVLVGLEETAQAQ
QLHQYSTDFLQELLTQPNRSDESRKQLTLKNIAFEQLAVEIAIQYGEIVQGLEIAEHGKN
ACLTWLLYGWTDKIYSPNYNSILQLLNPTTAAIYWHLSPSSLRTFIIKPNAPEPIPVFTP
MLNVAPDEFPLPEAVNRLVEFEDWLEDWNREYGDYRSEIRNKQTKRNHSWRQDMEQRLAR
LGKILSISTIEQELQGIENLILIPHRDLNRFPLHGLFSSKFAISYLPSLQIGLNLQQQNS
ATNQSSPKLLSVEHPDTKDYPPFKSAKLAALAISQMFDRAYRIQGDKATKGEVENALVGN
YDIFNFYGYANDEADASLSEILLAWEDKITLEEICKKPLNRYNLFTLSACEAAIDKKNIT
TEYAGLSSGLLSQGVSNVVNSLWRVESTANALVMIEFYRRLKAGNTPIIALKEAVAWLRE
LTAGELTKWYESLLNQLPPEGLRMKAQLATQLYRTSQMEADTKLYNHPYYWAAFVIGGID
S
Download sequence
Identical sequences K9RFU1
gi|427737217|ref|YP_007056761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]