SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737223|ref|YP_007056767.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737223|ref|YP_007056767.1|
Domain Number 1 Region: 3-195,343-581
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.68e-137
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000345
Further Details:      
 
Domain Number 2 Region: 598-817
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.61e-67
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000293
Further Details:      
 
Domain Number 3 Region: 194-344
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 2.62e-63
Family ValRS/IleRS/LeuRS editing domain 0.000023
Further Details:      
 
Domain Number 4 Region: 933-997
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0000000000000173
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737223|ref|YP_007056767.1|
Sequence length 998
Comment valyl-tRNA synthetase [Rivularia sp. PCC 7116]
Sequence
MTTNLPSVYDPISTEARWQKFWEEKLLYKADPNRDGEPYSIMIPPPNVTGKLHMGHAFDN
TLIDCLVRYHRMKGFNTLYLPGTDHASIAVQTIIEKQLKEEGKTRYELGREKFLERAWEW
KAQSKGTIVGQLRRLGVSVDWTRERFTMDSGLSKAVLEAFVRLYDEGKIYRGNYLVNWCP
ASQSAVSDLEVDQKEVDGKLWHFRYPLTDGSGYVEVATTRPETMLGDTGVAVNPSDERYN
KLIGRTLTLPIMNRQIPIIGDELVDPSFGTGCVKVTPAHDPNDFEMGKRHDLPFINIMNK
DGTLNENAGEFQGQDRFVARKNVIAKLEADGVLVKIENYKHTVPYSERGKVPVEPLLSTQ
WFVKIRPMADKALEFFEQNSPEFYPQRWGKVYKDWLVKLKDWVISRQLWWGHQIPAWYAI
SETNGEITENTPFVVAKSEEEAWEKAKSQFGEEVKLERDADVLDTWFSSGLWPFSTLGWP
QETEDLKKYYPTSVLITGFDIIFFWVARMTMMAGHFTEEMPFKDVYIHGLLLDENGKKMS
KSKGNGIDPLLLIDKYGTDALRYTLVKEVIGVGQDIRFDYNRKTDESPSVEASRNFANKL
WNAARFVMMNLDEETPQQLGVPEATELSDKWILSRFHQTVEETNSYMENYGMGEAAKGLY
EFIWGDFCDWYIELVKSRLQEDAEPKSRKVAQQTLAYVLEGILKLLSPFMPHITEEIWHT
LTQQPEDTGESLSLQKYPEANTQLIDSELESEFELLIGTIRTIRNLRAEADVKPSVKVTV
NLQSESARERQILNTGERLIKDLAKVENLTIADTQKSDTVTKKKSQTALKLIFLGFLTLT
LARVAYTVAITVENIPFFGTFFQFVGFGYSLWFIRVYLLPSKKRQELRQRFFKPSTEVNL
PEVETSQPEELGEVATGVVGTVQVLLPLEGVIDMNALRGKLEKNLSKIEAEVQSLTGRLS
NSKFVDKAPAEVVQGARDSLAEAEKQAEILRSRLERIN
Download sequence
Identical sequences K9RE38
gi|427737223|ref|YP_007056767.1| WP_015119786.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]