SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737320|ref|YP_007056864.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737320|ref|YP_007056864.1|
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily ITPase-like 1.36e-62
Family ITPase (Ham1) 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737320|ref|YP_007056864.1|
Sequence length 190
Comment RdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Rivularia sp. PCC 7116]
Sequence
MKLVVATSNPGKLKELQKYLADLNWDLVLKPQELEVEETGDTFEENARLKASEVAIATNS
WAIADDSGLQVDALNGAPGVYSARYGANDSGRIARLLTELGNETNRGAQFACAIALARPD
GTIALESEGVCRGEILYKTRGDGGFGYDPIFYVPHLQLTFAQMNSELKRSVSHRGKAMEG
LLPQIEKLIV
Download sequence
Identical sequences K9RGW8
WP_015119883.1.44015 gi|427737320|ref|YP_007056864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]