SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737461|ref|YP_007057005.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737461|ref|YP_007057005.1|
Domain Number 1 Region: 139-383
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.11e-41
Family Carboxylesterase 0.0000509
Further Details:      
 
Domain Number 2 Region: 49-132
Classification Level Classification E-value
Superfamily E set domains 0.0000000000875
Family E-set domains of sugar-utilizing enzymes 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737461|ref|YP_007057005.1|
Sequence length 383
Comment enterochelin esterase-like enzyme [Rivularia sp. PCC 7116]
Sequence
MPMIVKSFYISFIIALIFSQPAYGQLRKGFPAPSSIPNSEYPYINSDGKVTFRIKAPSAK
TVQVMGRDRNIPFGEKPTDLIRGEDGVWTVTIPIKPGFHYYQLIIDGTPVNDSASKAYFG
WGQYTSGLEIPNPKVDFDRVKKVPHGEVRERFYHSQVTGELRRVFVYTPPGYNADIQRRY
PVLYLQHGAGENERAWTKQGKANFILDNLIYSRQAVPMIVVMDNGYARKPGVELPPDSWG
NEAFGEVVIKDLIPLIDSQYRTIANRNYRAIAGLSMGGGQALEVGLNNLDKFSWVGGFSS
LLKNVDVDKSYDRVFTNPVLANLKLNLLWLGCGIEDDFYSTNNQASKALTEAGINHLWIQ
TEGGHEWLVWRRYLRDFAQLLFR
Download sequence
Identical sequences K9RG61
WP_015120023.1.44015 gi|427737461|ref|YP_007057005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]