SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737521|ref|YP_007057065.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427737521|ref|YP_007057065.1|
Domain Number - Region: 186-264
Classification Level Classification E-value
Superfamily L-aspartase-like 0.033
Family L-aspartase/fumarase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737521|ref|YP_007057065.1|
Sequence length 297
Comment hypothetical protein Riv7116_4081 [Rivularia sp. PCC 7116]
Sequence
MINPRFMRFFRHLNFKVLKEIVTNVGKRRLLGLSSEIAYNAILSLFPAILAILTAIGLLE
EGLQNIFKDLAQQISKVAPEDALNLITEFARNEIANSKNGSLFSLSFLAALWTSSGAIST
AMTALDQIQQTSSANIRPFWKAKLVSLGLTVGTIILLLIACLLVFISGELLNFVVDNSAG
YLNFLLYLWNLMRWPLALVIVASAFGFIYRYGPSNWKEGTPIMPGAIFAAICWAFVSNLF
RIYVANFGNYNKAYGAVGTVIVLMLWLYMTAAVILIGNQLNVTVGESMYPNSIKKMD
Download sequence
Identical sequences K9RGB6
WP_015120081.1.44015 gi|427737521|ref|YP_007057065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]