SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737647|ref|YP_007057191.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737647|ref|YP_007057191.1|
Domain Number 1 Region: 26-248
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.51e-54
Family Class I glutamine amidotransferases (GAT) 0.00000832
Further Details:      
 
Domain Number 2 Region: 422-542
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 3.14e-52
Family GMP synthetase C-terminal dimerisation domain 0.0000149
Further Details:      
 
Domain Number 3 Region: 208-435
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.35e-51
Family N-type ATP pyrophosphatases 0.00000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427737647|ref|YP_007057191.1|
Sequence length 542
Comment GMP synthase [Rivularia sp. PCC 7116]
Sequence
MKTAVTLLKQEASQAQKVELERQLNRQMIAILDFGSQYSELIARRIRETQVYSEVLSYRT
TAEQLRELNPQGIILSGGPSSVYDAKAPSCDPEIWNLGIPILGVCYGMQLMVQQLGGEVQ
KSERGEYGKAALHIDEPINLLANVEDGTTMWMSHGDSVLKMPAGFELLAHTANTPCAAIA
NPNKKLYGVQFHPEVVHSVGGLSLIRNFVYEICKSEPTWTTDAFVEESIREIRAKVGSKR
VLLALSGGVDSSTLAFLLHKAIGEQLTCVFIDQGFMRKLEPERLVKLFSEQFHIPVEYVN
ARERFIGALAGVTDPEEKRRIIGHEFIRVFEETSKELGPFDYLAQGTLYPDVIESADTNV
DQKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRCVGLPQEIVQRQPF
PGPGLAIRIIGEVTAQRLNILRDADLIVRQEINRNNLYSEYWQAFAVLLPIRSVGVMGDQ
RTYAYPIVLRIVTSEDGMTADWARVPYDILEVISNRIVNEVKGVNRVVFDITSKPPGTIE
WE
Download sequence
Identical sequences K9RH43
gi|427737647|ref|YP_007057191.1| WP_015120206.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]