SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737684|ref|YP_007057228.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737684|ref|YP_007057228.1|
Domain Number 1 Region: 16-257
Classification Level Classification E-value
Superfamily PP2C-like 0.000000000000314
Family PP2C-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737684|ref|YP_007057228.1|
Sequence length 259
Comment hypothetical protein Riv7116_4250 [Rivularia sp. PCC 7116]
Sequence
MNSSIQKLHWRVVGASVCGTSHVRNSQLCQDAHHWQMLPDNILVAAAADGAGSASLGKVG
AMVAVEAAIENISVKRINQDTLASDNSARSLLSEAILAAKTAVEEEAIASNRPPKDLATT
LIIVVATPIVAVVAQIGDGVAVAKDSMGNLTALTVPDSGEYINETSFLTSPTALDSVQVN
VWRQGITNIALLTDGLQMLAINMSVGLPHKPFFLPLFEFVANAEELKGAKEQLVKFLRSE
KITQRTDDDLTLIIAALSE
Download sequence
Identical sequences K9RGP3
gi|427737684|ref|YP_007057228.1| WP_015120243.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]