SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737688|ref|YP_007057232.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737688|ref|YP_007057232.1|
Domain Number 1 Region: 203-399
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.75e-67
Family B3/B4 domain of PheRS, PheT 0.00000534
Further Details:      
 
Domain Number 2 Region: 36-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-48
Family Myf domain 0.0022
Further Details:      
 
Domain Number 3 Region: 487-700
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.44e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 4 Region: 711-810
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 7.59e-32
Family Anticodon-binding domain of PheRS 0.00042
Further Details:      
 
Domain Number 5 Region: 413-494
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000833
Family Domains B1 and B5 of PheRS-beta, PheT 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737688|ref|YP_007057232.1|
Sequence length 811
Comment phenylalanyl-tRNA synthetase subunit beta [Rivularia sp. PCC 7116]
Sequence
MRISLNWLQELVELRLNPEELAETLTMAGFEVEDIEDRRTWADGVVIGKVVEREQHPNAD
KLSVCQVDVGKGENLNIVCGAANVRADIYVPVATVGTYLPNKDLKIKPAKLRGVPSQGMI
CSLEELGLPTDVDGIHIFSGDNIQIGDDVRPLLGLDDVILDVTATANRADALSMVGIARE
VAAITGGKLKIPDPEKVSVAQNAGSFSIKVDDTKACPAYIGTVIGQVKIAPSPDWLQQRL
LSAGVRPISNIVDITNYVMLEWGQPLHAFDLTRLQSIAASEDISIGVRFANNGENFKTLD
GKSRNLSTQNLLITVNNKPVALAGVMGGEESEVHDGTESLVLEAALFDNVAIRRSSRSVG
LRSESSTRYERGVNHAELEVACNRALSLIVEIAGGTLKAQEISDTRPDSGWTRSIELRLD
RVNQILGPVDLGEEETGEIKGGDVERILTALGCRLTVSGDGTWAVNVPAYRYRDLEREID
LIEEIARLYGYDNLCDTLPEKPEVGYLPTDQELIRKLRAAFRAIGLTELMHYSLVKPGED
RQVVLSNPLFAEYSALRTDLISGLIDAFQYNIEKGNGALNGFEIGKIFWEEEDGFQEADT
VGGIIGGDITSSKWMSGGSQKSISWFEAKGILESVFKVMGLQVEYQPDRRDDRLHPGRTA
SLWVGGNRLGVFGQVHPQIRSEKDLPDDVYVFQLSLEVLLDAVDEDDILTPKFKSFSTYP
PSDRDIAFFAPVDLTVADIEKAINKAGKSLLDSVELFDEYRGENVPEGQRSLAFRLIYRS
PERTLTDADVEPVHQKVRDSLVEKFGVSLRS
Download sequence
Identical sequences K9RFE9
gi|427737688|ref|YP_007057232.1| WP_015120247.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]