SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737710|ref|YP_007057254.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737710|ref|YP_007057254.1|
Domain Number 1 Region: 40-219
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 7.85e-42
Family Phosphoglucomutase, first 3 domains 0.00041
Further Details:      
 
Domain Number 2 Region: 297-404
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.49e-28
Family Phosphoglucomutase, first 3 domains 0.0036
Further Details:      
 
Domain Number 3 Region: 195-295
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.1e-26
Family Phosphoglucomutase, first 3 domains 0.0005
Further Details:      
 
Domain Number 4 Region: 400-489
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.02e-21
Family Phosphoglucomutase, C-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737710|ref|YP_007057254.1|
Sequence length 491
Comment phosphoglucosamine mutase [Rivularia sp. PCC 7116]
Sequence
MVSFITGNRSNFRRDSASEVNGWKNASASGFGQNSLILPKSPLFGTDGIRGKVGELLSAP
LALQVGFWTGIVLRSRAQNIGPVILGQDSRNSSDMLAMALSAGLTAAGLQVWYLGLCPTP
CVAYLSSITDAVGGVMISASHNPPEDNGIKIFGADGIKLSKALQQEIEAGLRGQASPAVS
VSNCGRHYSRPELISEYAQILKQPLHGNVNLQGMKVVLDLAWGAAVGLAPSVFEELGAEV
ICLHNSADGDRINVGCGSTHLGILQAAVKENNADLGFAFDGDADRVLAVDNTGREINGDY
ILYLWGNSLQQRQELPDNLIVSTVMANLGFERAWKQIGGQFTRTAVGDQHVQAEMLRSGG
MLGGEQSGHILCRHYGITGDGLLTALHIAALVHQADVPLSEMVSQSFVTYPQLLQNVRVE
DREKRVGWKECQPVQQAISHAQAAMGDSGRVLVRASGTEPLIRVMVEAESAELANHWTKE
LVNVVQQNLAA
Download sequence
Identical sequences K9RHY0
gi|427737710|ref|YP_007057254.1| WP_015120269.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]