SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737753|ref|YP_007057297.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737753|ref|YP_007057297.1|
Domain Number 1 Region: 220-340,574-638
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.55e-46
Family Intein (protein splicing domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 639-854
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.18e-38
Family RecA protein-like (ATPase-domain) 0.0073
Further Details:      
 
Domain Number 3 Region: 13-124
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 4.71e-32
Family N-terminal domain of DnaB helicase 0.00023
Further Details:      
 
Domain Number 4 Region: 417-516
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000283
Family Intein endonuclease 0.035
Further Details:      
 
Weak hits

Sequence:  gi|427737753|ref|YP_007057297.1|
Domain Number - Region: 179-220
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00123
Family RecA protein-like (ATPase-domain) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427737753|ref|YP_007057297.1|
Sequence length 869
Comment replicative DNA helicase [Rivularia sp. PCC 7116]
Sequence
MSEELNFQGNAERLPPQNIEAEEAILGGVLLDPEAISRISDILKPEAFYISAHKDIYTGM
LQLQTQGKPTDLLSVLSWLNDHELLEKVGGRNKLASLVDRTVSAVNIDALAALVVEKYRR
RQLIRAGNEIVSLGYETETEFRSVIDKAEQKVFGIAQARNTSGLVHISNTLINTFTDIEE
RHEGIALPGIPCGFYDLDAMTSGFGRSDLIIVAGRPSMGKCLHEDAELVLSDGSISTIKE
IYNNQQAELLTLQKNWKFGYTKPEAFINDGIKPVFGVKTRLGRYIETTITHPYLTINGWR
KLSELKVGDKIAVPRKIEVFGTQQIRECEVKLLAYLIGDGCLTDTTPKFSNNNPSIVQDF
SLSVTDFSPQLKIKEKRRSKRSPILNVETYEAKDNPLILWLQELELWGKKAEEKTLPGFV
FTLERQQIALFLNRLFAIDGWASVLKSGQVQLGCYCVNEKFSRQIQHLLLRFGIIATLKT
RSIKYKSTIRTAWQLDITNARAIKNFVSEIGIFGKQEILVKVKAALLQKRYQTNRDLIPI
EVWKQLAVAKEEETWTGLAKRAGIKGYSNIHVGKRALSRERLFQLATALENLRLQQLASS
DIYWDEIVSIEPMGNKQVYDLTIPHTHNFVANDICVHNTAFCLNLAHNIASLYKLPVAVF
SLEMSKDQLVQRLLSSEAEIESTYIRTGRISQTQWEPLSRAISILSEMPIFIDDTPNITV
TEMRSQARRLQAEAGTDIGLVIIDYLQLMEGGGDNRVQELSKITRSIKGLARELGAPVIA
LSQLSRGVEARTNKRPMLSDLRESGSIEQDADLVMMLYRDEYYNTDSPDRGIAEVIIAKH
RNGPTGTIKLLFDPQFTKFKNLAQPSHYS
Download sequence
Identical sequences K9RFL2
gi|427737753|ref|YP_007057297.1| WP_015120312.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]