SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427737931|ref|YP_007057475.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737931|ref|YP_007057475.1|
Domain Number 1 Region: 18-503
Classification Level Classification E-value
Superfamily ADC synthase 5.63e-124
Family ADC synthase 0.00000215
Further Details:      
 
Domain Number 2 Region: 527-717
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.4e-47
Family Class I glutamine amidotransferases (GAT) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737931|ref|YP_007057475.1|
Sequence length 732
Comment anthranilate synthase [Rivularia sp. PCC 7116]
Sequence
MQFDTSSYTTQGGIFISRTVTNTSIDSAIDEVLMRLDSQRGGLLASSYEYPGRYKRWAIG
FVNPPLEISTRDRTFKITAHNERGLVLLDFLTNLLLDKPYIQELNQADNCISGSIKPSDR
LFSEEERSRQPSVFSVIREIISAFFSPLDENLGLYGSLGYDLVFQFEQMPKQLQREDDQR
DLVLYLPDELLVVDYHLQQAFRMQYDFVTKNGSTRDLPRKGEKIDYRGKRLNVTQGSDHA
PGEYQQQVVKALDYFRRGDLFEVVPSQCFSETCEKSPTELFRTLRKINPSPYGFIFNLGG
EYLIGASPEMFVRVEGRRVETCPISGTIKRGGTAIDDAVQIQKLLNSRKDESELTMCTDV
DRNDKSRICEPGSVRVIGRRQIEMYSHLIHTVDHVEGVLKPEADALDAFLTHLWAVTVTG
APKRSAMQFLEQNERSARRWYGGAVGGFNFRGGLNTGLILRTIRLQDSIAEVRVGATVLY
DSDPEAEAQETLTKGGALFQALNRASHQEVALPIVPEFGIKEAKPAAGKKVLLIDYEDSF
VHTLANYIRQTGATVTTLRHGFPESVFDEQKPDLVVLSPGPGRPSDFNLESAIAACKKRE
IPIFGVCLGLQGIVEAHGGKLGVLDYPQHGKTSLVNVVDKNSVAFKDLPENFEVGRYHSL
HALQDSLPEELKITAISQDGIVMGIEHKTLPIAAVQFHPESIMTLVGGAGLTIITNVVSE
FTCSAKGVVLAS
Download sequence
Identical sequences K9RHJ1
WP_015120490.1.44015 gi|427737931|ref|YP_007057475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]