SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427738207|ref|YP_007057751.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738207|ref|YP_007057751.1|
Domain Number 1 Region: 144-480,509-584
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.84e-138
Family Amylase, catalytic domain 0.000000283
Further Details:      
 
Domain Number 2 Region: 22-154
Classification Level Classification E-value
Superfamily E set domains 1.19e-30
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 
Domain Number 3 Region: 596-702
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.16e-19
Family alpha-Amylases, C-terminal beta-sheet domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427738207|ref|YP_007057751.1|
Sequence length 703
Comment glycogen debranching protein GlgX [Rivularia sp. PCC 7116]
Sequence
MFIERIDIHPTHTKDKFKLRCGKPFPFGATLISGGVNFSIFSRHATSCTLVLFDKHASEP
MAEIPFPKEFRIGNVYCMVVFDLDYENIEYGYRMDGPNNFSEGHWFDSSKILLDPYAKII
GGRDVWGVQPNWDDIYQHRAKIAFEDFDWQDDCLLEIPSEELIIYEMHVRSFTKHPSSNV
KHPGTFAGIREKIPYLKELGINAVELMPIFEFDEFENSRQSPQTGETLLNYWGYSTLGFF
APKAGYAATGKLGMQADELKALIKALHQNGIEVILDVVFNHTAEGNEQGHYISFRGIDNQ
TYYMLTPEGYYYNFSGCGNTLNCNNPIVRGMVLDCLRYWVSEYHIDGFRFDLASILGRDP
WGAPLSNPPLLETLAFDPVLAKCKLIAEAWDAGGLYQVGSFPDYGRWAEWNGKYRDRIRK
FIKGDANVQDMALRLQGSPDLYAHTCRTPSASINFITAHDGFTLADLVAYNDKHNEANGE
NNNDGENSNNSWNCGIEGWTENQSVNSLRQRQIRNALAILMMSQGVPMLLMGDEIGRSKQ
GNNNTYCHDNELNWLDWTLLSKNSDLFKFVKNCIAFRKAHPILRQKNFLDRDSNNGYPDI
TWHGIRAWNPDFSDSSRTTAFMLRGRKANQHQKDDYIYVAMNMHWETHGFEIPKLNTSIK
WHIFVNTGVTSPEDSWEPGCEPLLDNQQEILVGSRSVIILVGR
Download sequence
Identical sequences K9RIR0
WP_015120763.1.44015 gi|427738207|ref|YP_007057751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]