SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427738339|ref|YP_007057883.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738339|ref|YP_007057883.1|
Domain Number 1 Region: 46-343
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-91
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 8-44
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000392
Family Pentapeptide repeats 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427738339|ref|YP_007057883.1|
Sequence length 345
Comment WD40 repeat-containing protein [Rivularia sp. PCC 7116]
Sequence
MKVDKTALEGRDFSGAVVKGANFSDISLRDVNFADAKLIESFFTKIFGTIFSIAYSFDGQ
LIATGDGDGVVRIWEVASNKEILTCNGHTGGILSVDFSSDSYKLASSSYDGKIRLWDTCT
GKCLVALQGHSSSVYSVVFCSEDKIIASGSSDGTVRLWNINTGQCLQILQSNTNSVHSIV
FNPNNKMLASCGNHNTIELWDIQTYQCLKTLQGHTNFVASVAFSPDGKTLASGGYDQTVK
LWNVNTGKCESTLQAHNVSVLAVAFSPDGKILASGHDKTIQLWHLETGECLKTLKGHFHL
VRSIAFSPDGETLASGSYDKTVRFWSIATAECQKVLQGHSTWVNL
Download sequence
Identical sequences K9RIL7
gi|427738339|ref|YP_007057883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]