SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427738655|ref|YP_007058199.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738655|ref|YP_007058199.1|
Domain Number 1 Region: 112-463
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.38e-91
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000554
Further Details:      
 
Domain Number 2 Region: 464-586
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.01e-34
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00062
Further Details:      
 
Domain Number 3 Region: 8-101
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 3.53e-24
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427738655|ref|YP_007058199.1|
Sequence length 586
Comment arginyl-tRNA synthetase [Rivularia sp. PCC 7116]
Sequence
MNATQEHLREKLKQALGKAFGDEYANTDPILVPASKPEFGDYQANMALSLAKKLGQKPRD
IANQVVENLDVSDICEKPEIAGPGFINLRLQTSYLEAQLNSIQKDERLGVPTAKQPKREV
VDFSSPNIAKEMHVGHLRSTIIGDAIARILEFRGHDVIRLNHVGDWGTQFGMLITNLREV
SPSALTTANALDIGDLVNFYKQAKKRFDEDEEFQEKSRNEVVKLQAGAEDTIHAWKLLCE
QSRKEFQVIYDLLDIKVEERGESFYNPLLPEVVEDLDKAGLLESSDGAKVVFLKGFKNRD
GQPLPLIVQKSDGGYNYATTDLAALRHRIQKEEAKRLIYVTDAGQANHFAGVFQVANRAN
WIPEDVEIVHVPFGLVLGEDGKKLKTRSGETVRLRDLLDEAVSRCREDLEKRLKEEEGRE
ETEDFIANVAKVVGISAVKYADLSQNRTGNYKFSFDKMLALKGNTAPYMLYAYARTQSIS
RKGDIDYENLGENIKIVLKEEAEFTLAKHILQLDEVIAEVEKELLPNRLCEYLYQLSEKF
NQFFENCPVLKSEEPIKTSRLALCDLTARTLKLGLNLLGIEVLERM
Download sequence
Identical sequences K9RKN0
gi|427738655|ref|YP_007058199.1| WP_015121209.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]