SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427738766|ref|YP_007058310.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738766|ref|YP_007058310.1|
Domain Number 1 Region: 124-252
Classification Level Classification E-value
Superfamily alpha/beta knot 5.04e-27
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0026
Further Details:      
 
Domain Number 2 Region: 21-115
Classification Level Classification E-value
Superfamily L30e-like 0.0000000000167
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427738766|ref|YP_007058310.1|
Sequence length 286
Comment rRNA methylase [Rivularia sp. PCC 7116]
Sequence
MALGNISNQTQPLKLESHAAKLNEIRKLQTHRTYRDSTKQFYVEGIRNFIRILDNKFDIS
TIIYSEKLLTSVIARKLVRQKRRAGIPCLNISPEKFRTISHTEKASGVGAIVHQHWTKLH
DIPLQERTCWIILETVRSPGNLGTLIRTSEAFGGAGFIFLGNSIDPFDPNVVRASMGSIY
NQKFIRTGYSKLYKWLQNHNCHVIGASPDGAVDIHKFEYPATTMIFLGEERKGLTQQQRD
LCKHLVRIPLTSPSFEKNWDSKQLSLRSLKTYCVTLFACDKTFLDY
Download sequence
Identical sequences K9RJU7
WP_015121319.1.44015 gi|427738766|ref|YP_007058310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]