SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427738845|ref|YP_007058389.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738845|ref|YP_007058389.1|
Domain Number 1 Region: 872-1168
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-98
Family WD40-repeat 0.00000562
Further Details:      
 
Domain Number 2 Region: 1166-1462
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.76e-98
Family WD40-repeat 0.00000431
Further Details:      
 
Domain Number 3 Region: 372-561
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000665
Family RecA protein-like (ATPase-domain) 0.053
Further Details:      
 
Domain Number 4 Region: 834-874
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000235
Family Pentapeptide repeats 0.015
Further Details:      
 
Weak hits

Sequence:  gi|427738845|ref|YP_007058389.1|
Domain Number - Region: 116-159
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0981
Family Mitotic arrest deficient-like 1, Mad1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427738845|ref|YP_007058389.1|
Sequence length 1493
Comment WD40 repeat-containing protein [Rivularia sp. PCC 7116]
Sequence
MLDKLIGEIGNFAKAKLQRNEKVIILLKKFNLDPDHPPADFSGIYSYALVEYGVGKSLAI
LQLFREDEIQKAFHKAFDADNPNIVIEEIGKILQPDEWNILEEGIREEGIDVLHELAEFS
AVFLKVVQLTRTPAEVQRDKNIANLQQELSTIKQELQQLGTLGEIRTELAKLTNLEKPHP
AFGTPLLTKERGRAKQQKCKAENLAIQLHGWFKTLGYQFEKYQVWQADYFELIIKIQGRR
RFDRILVRGIDGEATISDLINLRQSVKSQKTDEGWLIAARRISRAARDEVNKDENENLFC
YTLDELIDETADFSNYINWLETEVKKRKIDELYVPLACSKEEIDPLTKQKIGLSRYDEQD
GWIDGYVDTWIDDPAKEHLSILGEFGTGKTWFSFNYAWNALLKYKEAKQRGLSRPRLPLV
ILLRDYAKALDVENVMAGFFYSQHEISLNSSVFEQLNRMGKLLLIFDGFDEMAARVDKQQ
MVNNFWELAKVVVPGAKVILTCRTEHFPEAKQGRSLLNAELRASVANLTAESPQFEVLEL
EKFSDEQIRQVFSHVVNTSTVDKVMHNPQLLDLARRPVMSDLILEALPDIEAGKPVDMSR
VYLYAVRRKMERDIKSERTFTSLADKMYFLCEIAWEMLSNDQMSLNYRLFPDRIRRLFGD
AVEEQKDLDHWHYDMMGQTMLVRNADGNYTPAHRSLLEFFVAYKFAGELGVLADDFLEVV
RKNFGGEQETLALEFCETKSLSQQFSWGEYFQSYREKTIALEKFEFKSEPLEKLRNTVGR
SPLTKAVLDLLVGMVDQDSVGDKLLEVIKETKGKSEGEVGYVGGNAATVLVKVDNCAIED
TDLSGAIVKGGDFRDTSLLYVNFQNTNLANCEFTKPFGMILSLAFSPDDKLLVTGGADGE
IRMWELESGKQILNFRGHNDWVSSVAFNFDGKIIASCSHSSAIKLWDSKTGECLKILRGH
TNKVRQIAFDSNSTILASCSDNRIIKLWDVSTEKCINTLRGHTGRIWTVAIAPNNKIVAS
GSYDSSVKIWDILTGDCLQTLHEHDHRVISVVFSHDSKILASGSKDKIIKIWDINTGKCI
KNLIGHTKTIRSLVFSKDNQTLFSASSDSTIKVWSINDGKCLKTITGHKNRIRTIALNSK
DTVLVSCSDDQTIKLWHTNTGECLQALQGCKHWVASVTVSPDGKTIISGSNNQKIKFWYI
KTGRCFRTIRGHDKWISSVTISPDSRIIASGSGDRTVKIWDFNTGNCLKAFQAHINPVSD
VTFSNDGLTLASTSHDQTIKLWDVKNGKCLHTFQGHTDWVNSVVFSRDGKTVISNSNDCT
IKLWHINTGKCIKTLQGHDAAIWSVAVATDGTTIASGSRNGIIKIWDIHSGKCLKTLQDN
HCGIESVQFSHDGLLLAASSIDQTINIWNAATGEFIKTLKGHKNRVTSVAFTPDDKFLVS
GSYDGTIKIWNIQTGECIKTLSNKPYANMNITNATGLTPEQKSSLKALGAIEQ
Download sequence
Identical sequences K9RLA0
WP_015121398.1.44015 gi|427738845|ref|YP_007058389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]