SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427738847|ref|YP_007058391.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738847|ref|YP_007058391.1|
Domain Number 1 Region: 4-238
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.23e-67
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000659
Further Details:      
 
Weak hits

Sequence:  gi|427738847|ref|YP_007058391.1|
Domain Number - Region: 245-346
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.00654
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427738847|ref|YP_007058391.1|
Sequence length 424
Comment nucleotidyltransferase/DNA polymerase [Rivularia sp. PCC 7116]
Sequence
MSQIIALVDCNNFYCSCERVFNPKLENRPVVVLSNNDGCVVARSNEAKALGIKMGEPAFK
LREYRDKYNLAILSSNYTLYGDMSQRVMQCLAEYTPELEIYSIDEAFLDFTSFTNQDLTA
YSREIKQKVQQFTGIPISIGIATTKTLAKVANRIAKKSNKAKGVLNLVNSPYLDLALQRT
EVGDVWGVGSSYTKLLEKNNIHNALQLKKTDQKWIRKERGIVGLRTVLELNGTSCIPLAE
MPNSKKSTAVTRSFGKAVETLAELQEALSAYAYRAGEKLRQSKLETASMTVFFRTGSYDK
SQPYRSWGTTVNLFSSTNDSRELVNNARKVAENLFEPGYKIKKAGVILLGLTPEGEKQLS
LFEKSEPDKKRSQGLMQVMDTINHRYGRETIQLASSGIRKKWQMKADYKSPKYTTSWDEL
PKVG
Download sequence
Identical sequences K9RKR3
WP_015121400.1.44015 gi|427738847|ref|YP_007058391.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]