SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427739017|ref|YP_007058561.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739017|ref|YP_007058561.1|
Domain Number 1 Region: 44-367
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.03e-31
Family Galactose oxidase, central domain 0.00082
Further Details:      
 
Domain Number 2 Region: 369-468
Classification Level Classification E-value
Superfamily E set domains 1.39e-23
Family E-set domains of sugar-utilizing enzymes 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427739017|ref|YP_007058561.1|
Sequence length 469
Comment hypothetical protein Riv7116_5646 [Rivularia sp. PCC 7116]
Sequence
MPWEVSSTCPINPVHAALLRTGKVLFFTGSGNNPNDIPNADKGSALFDVQNGTFTRPEIP
RNSNGTPIDIFCAGQAFRPAGNLLVAGGTLRYDPFFGEVASFFFSPTSEKWSKRQSMNGG
RWYPTLVSLGNGQTLALSGLNETGNLNRFPELYSYSKGWRIFTSETSPFEQYAHVYLLDN
GKLFYSGAQLGGNRGVSPRIITLPKNFSDTIGEQPVGGLQDSGKGNQAASVLLPPAQDQR
VMIAGGGGGGTTARVNIVDLKSSNPSYQPAASLNNARMHHNAVILPNRTVFVCNGSGGNE
DIGKSDLPAEIYDQATDTWTEVEDPSINGRVYHSVALLLPDGRVLTAGGNPFRGSVEFRI
EIYSPDYIAANRPVINQAPSKASWGSSFTIETPQAGDIKWVNLVRPMATTHGLENEQRLV
DVPINSSTGNSLTVDLTSNRNLAPPGWYMLTIVDNNNVPSVAKWVKVKK
Download sequence
Identical sequences K9RL61
WP_015121567.1.44015 gi|427739017|ref|YP_007058561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]