SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427739079|ref|YP_007058623.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739079|ref|YP_007058623.1|
Domain Number 1 Region: 10-192
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.55e-52
Family Methylesterase CheB, C-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1040-1212
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-46
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 3 Region: 277-470
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.59e-44
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00025
Further Details:      
 
Domain Number 4 Region: 1238-1357
Classification Level Classification E-value
Superfamily CheY-like 1.18e-37
Family CheY-related 0.007
Further Details:      
 
Domain Number 5 Region: 976-1051
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0021
Further Details:      
 
Domain Number 6 Region: 826-954
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000704
Family BphP N-terminal domain-like 0.082
Further Details:      
 
Domain Number 7 Region: 731-838
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000362
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 8 Region: 202-278
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000405
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|427739079|ref|YP_007058623.1|
Domain Number - Region: 642-722
Classification Level Classification E-value
Superfamily Tropomyosin 0.0177
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427739079|ref|YP_007058623.1|
Sequence length 1358
Comment PAS domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MTNPSSESRDFFIIGIGASAGGVQALEAFFSNLPDHPSAAFVIIQHLSPDYKSMMAEIIQ
RKTQLPVHEIVDGVKIEPSHAYVLPPGKLVIIKDGQLRLQKRNRSFGYPVNKFFKSAAQD
WGEKVVGIVLSGTGNDGTEGLKAISQWGGIGLVQSPETAQFNSMPSSAIPSGLVDEILSP
QDLARTVFELISFSQKNPSISPQDITLIDTDILQQILNILAENEEIDFSHYKISTLARRI
HRRCALTSSINLENYTALLETSEEEQKLLRQDLLIGATCFFRDRPAWEYLQQHVLPQITA
QIEPQQHLRIWVSACATGEEAYTMAMLVNEAVEKSGKTLHVKVFATDVDTNALENAARGS
YPESIIHDISPYLLEKYFVRNGDRYQVKHFLREMLIIAPHDLTKNAGFSKMHLVSCRNVL
IYMQPHLQQQVLRLLHFAIAPQGILFAGSSETLGDLNEEFVPLDSKWKIFRKKRDIPLSL
APLSRQPIITPIPANARTKTRQNQFDRVLGEVFKQCLGERQLTCVLVNGENQMVRVFHNS
ARLLDYPLGEAMLDITEIVHPALRLPLSTALHRAKRDKKEVLYTGIKLKRDELEENVSLK
VGLDSTNISIEELFIIVLEIETQLSITKTPSLRFEIDTEAAQQINELEYELQQTRENLQV
TIEELETTNEEQQATNEELLASNEELQSTNEELQSVNEELYTINAEYQSKIQELTQLNND
IDNLLRSTDIGVVFLDCQLNIRKFTPAATRAINIRANDVERPLAHFTHNLDCPNLIEILQ
QVVDTGEATEHEVSISQSSEKLLMRVNLYLREDGRNDGIVLTFVNINELKKVQQQLHQAN
VLLENLYVTSPVGLSLHDQDLRYLRVNKTLADINGISISEHIGKTVAEISSDLAQAIEPS
LKNVSETGRAICDVEITGKTIQKPDIERCWTASYYPVKLLDGTRGVGTVITEITDRKRTQ
QELLRQNQALEDAIAVAQAADSANQAKSEFLANVSHEIRTPMNAVLGVSQLLQYTELSSR
QSGLLIKLRSNGERLLEIINDVLDLSKIEARELRLNRNNFNIDKLGDNLLHLFAIQAEEK
GIQFTINIAPDMPKNLIGDDFRLQQVLSNLIGNAIKFTDNGEVSVHISSETQDTFQNSVK
LHFRVSDTGIGIDPEVKENLFKPFTQADGSTTRKYGGTGLGLTICRRIIDLMGGEIAVQS
NPGEGATFWFTVSLDRSETEVESDLQSTATIIDSSSAKNLKILIVEDYVDSREIVVFMLE
ELGYQAEAVSNGEQALDKLAESDFDIVFMDCQMPVMDGYEATRQLRQREGEQRHTLIIGL
TANAMYDDREKCLNAGMDNYLSKPVMMENLERIINNYQ
Download sequence
Identical sequences K9RKM7
WP_015121628.1.44015 gi|427739079|ref|YP_007058623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]