SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427739486|ref|YP_007059030.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739486|ref|YP_007059030.1|
Domain Number 1 Region: 832-1026
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.85e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000476
Further Details:      
 
Domain Number 2 Region: 299-501
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.31e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000345
Further Details:      
 
Domain Number 3 Region: 673-722,809-858
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.6e-29
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0021
Further Details:      
 
Domain Number 4 Region: 568-672
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.26e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00028
Further Details:      
 
Domain Number 5 Region: 40-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.86e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00012
Further Details:      
 
Domain Number 6 Region: 147-184,277-333
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.75e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0016
Further Details:      
 
Domain Number 7 Region: 185-275
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 6.15e-22
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00028
Further Details:      
 
Domain Number 8 Region: 723-806
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 8.11e-20
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427739486|ref|YP_007059030.1|
Sequence length 1061
Comment hydrophobe/amphiphile efflux-1 (HAE1) family transporter [Rivularia sp. PCC 7116]
Sequence
MFVENFIRRPVLTIVCSIIILLVGAVSIPTLAVEQYPDVSPVQVVVSANYIGASAEVVED
TVTTVLERQINGIKGMRYISSTSSDDGSSSITVTFEQGYDLDIAAVDVLNRVSIAEAQLP
QAVQRTGVNVFKQSSSVVVGMSIFSEEEGVYDDNFVSNYADLYVVDSIKRIDGVSDMQPF
GERRYAMRLWLDPSLLASRGVTAQDVVAALQTQNVQIGAGRIGQPPTNDGQRYQLTIRAA
GRLQDVTQFEEIVLKTGENGSLVKLKDVGRAELGAENYDTFARYRGQGAIGYRVLQTPGS
NALAAAKAVKARMKELAEDFPPGLSYAIPYDPTLFVEESSKEVVSTLIQAILLVVLVLFL
FLQNWRATIVPAVVIPVALIGTFAFIKVFDFSINSLTLFGLTLATGMVVDDAIVVVEDIG
GKVQEQGMRPHLAAIEAMGELSGAVIATSLVLLAVFIPVAFFPGTTGQLYQQFALTISFA
VIISTFNALTLTPALSSLLLRQGQEPTGWLAKIFAVINRGIDLMRSGYRSILEILTNFKL
VVLGVFAFLLAITVWMYQTVPTAFLPDEDQGYVINLLQGPEGTSLEYTGEVMEQVDKQYL
DIPEVRGTFSLGGFSFSGRAANYGISFVPFEPWGDRKDPEKSAASILNRVRGGLAGISQA
RVIAFNPPAIQGLGSIGGFVFQLQDKGNNDIQTFIKVKDELIQKANARPELQGVFSTYSA
SAPQLLMEVNRDRANSLQVPVDQVLSTVGTLIGSNYVNDFNAFGRTYRVYVQADKEFRSN
PKNINQFYVRSQQGTMIPLGDLIEIKNLTGPQTVNHYNLFPSIEINGSPAEGYSSGQAIA
AMEEIAEEVLPQNMDFEWSGITLEEIQSGGQAPIIFGLGILFVFLVLAAQYENFVDPVII
LLAVPLAILGALLAQSVRGLPNDVYCQVGLVMLIGLASKNAILIVEFANQLREQGLSITR
AAVQASEQRLRPIVMTAISTLLGIFPLVIATGAGAASRQSLGTAVFGGMIVSTVLSLFVV
PVLYIVISTLFSNFKNDCQSLSPEKQQAREEERETVGVGKR
Download sequence
Identical sequences K9RLX7
gi|427739486|ref|YP_007059030.1| WP_015122035.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]